KEGG   Homo sapiens (human): 53343Help
Entry
53343             CDS       T01001                                 

Gene name
NUDT9, NUDT10
Definition
(RefSeq) nudix hydrolase 9
  KO
K13988  ADP-ribose pyrophosphatase [EC:3.6.1.13]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    53343 (NUDT9)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.13  ADP-ribose diphosphatase
     53343 (NUDT9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NUDIX
Motif
Other DBs
NCBI-GeneID: 53343
NCBI-ProteinID: NP_076952
OMIM: 606022
HGNC: 8056
Ensembl: ENSG00000170502
Vega: OTTHUMG00000130591
Pharos: Q9BW91(Tbio)
UniProt: Q9BW91 A0A024RDI6 Q96KB3
Structure
PDB: 

Jmol
Position
4q22.1
AA seq 350 aa AA seqDB search
MAGRLLGKALAAVSLSLALASVTIRSSRCRGIQAFRNSFSSSWFHLNTNVMSGSNGSKEN
SHNKARTSPYPGSKVERSQVPNEKVGWLVEWQDYKPVEYTAVSVLAGPRWADPQISESNF
SPKFNEKDGHVERKSKNGLYEIENGRPRNPAGRTGLVGRGLLGRWGPNHAADPIITRWKR
DSSGNKIMHPVSGKHILQFVAIKRKDCGEWAIPGGMVDPGEKISATLKREFGEEALNSLQ
KTSAEKREIEEKLHKLFSQDHLVIYKGYVDDPRNTDNAWMETEAVNYHDETGEIMDNLML
EAGDDAGKVKWVDINDKLKLYASHSQFIKLVAEKRDAHWSEDSEADCHAL
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atggcgggacgcctcctgggaaaggctttagccgcggtgtctctctctctggccttggcc
tctgtgactatcaggtcctcgcgctgccgcggcatccaggcgttcagaaactcgttttca
tcttcttggtttcatcttaataccaacgtcatgtctggttctaatggttccaaagaaaat
tctcacaataaggctcggacgtctccttacccaggttcaaaagttgaacgaagccaggtt
cctaatgagaaagtgggctggcttgttgagtggcaagactataagcctgtggaatacact
gcagtctctgtcttggctggacccaggtgggcagatcctcagatcagtgaaagtaatttt
tctcccaagtttaacgaaaaggatgggcatgttgagagaaagagcaagaatggcctgtat
gagattgaaaatggaagaccgagaaatcctgcaggacggactggactggtgggccggggg
cttttggggcgatggggcccaaatcacgctgcagatcccattataaccagatggaaaagg
gatagcagtggaaataaaatcatgcatcctgtttctgggaagcatatcttacaatttgtt
gcaataaaaaggaaagactgtggagaatgggcaatcccaggggggatggtggatccagga
gagaagattagtgccacactgaaaagagaatttggtgaggaagctctcaactccttacag
aaaaccagtgctgagaagagagaaatagaggaaaagttgcacaaactcttcagccaagac
cacctagtgatatataagggatatgttgatgatcctcgaaacactgataatgcatggatg
gagacagaagctgtgaactaccatgacgaaacaggtgagataatggataatcttatgcta
gaagctggagatgatgctggaaaagtgaaatgggtggacatcaatgataaactgaagctt
tatgccagtcactctcaattcatcaaacttgtggctgagaaacgagatgcacactggagc
gaggactctgaagctgactgccatgcgttgtag

DBGET integrated database retrieval system