KEGG   Homo sapiens (human): 53343Help
Entry
53343             CDS       T01001                                 

Gene name
NUDT9, NUDT10
Definition
nudix (nucleoside diphosphate linked moiety X)-type motif 9 (EC:3.6.1.13)
Orthology
K13988  
ADP-ribose pyrophosphatase [EC:3.6.1.13]
Organism
hsa  Homo sapiens (human)
Pathway
Purine metabolism
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:hsa00230]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
4q22.1
AA seq 318 aa AA seqDB search
MAGRLLGKALAAVSLSLALASVTIRSSRCRGIQAFRNSFSSSWFHLNTNVMSGSNGSKEN
SHNKARTSPYPGSKVERSQVPNEKVGWLVEWQDYKPVEYTAVSVLAGPRWADPQIRNPAG
RTGLVGRGLLGRWGPNHAADPIITRWKRDSSGNKIMHPVSGKHILQFVAIKRKDCGEWAI
PGGMVDPGEKISATLKREFGEEALNSLQKTSAEKREIEEKLHKLFSQDHLVIYKGYVDDP
RNTDNAWMETEAVNYHDETGEIMDNLMLEAGDDAGKVKWVDINDKLKLYASHSQFIKLVA
EKRDAHWSEDSEADCHAL
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atggcgggacgcctcctgggaaaggctttagccgcggtgtctctctctctggccttggcc
tctgtgactatcaggtcctcgcgctgccgcggcatccaggcgttcagaaactcgttttca
tcttcttggtttcatcttaataccaacgtcatgtctggttctaatggttccaaagaaaat
tctcacaataaggctcggacgtctccttacccaggttcaaaagttgaacgaagccaggtt
cctaatgagaaagtgggctggcttgttgagtggcaagactataagcctgtggaatacact
gcagtctctgtcttggctggacccaggtgggcagatcctcagatcagaaatcctgcagga
cggactggactggtgggccgggggcttttggggcgatggggcccaaatcacgctgcagat
cccattataaccagatggaaaagggatagcagtggaaataaaatcatgcatcctgtttct
gggaagcatatcttacaatttgttgcaataaaaaggaaagactgtggagaatgggcaatc
ccaggggggatggtggatccaggagagaagattagtgccacactgaaaagagaatttggt
gaggaagctctcaactccttacagaaaaccagtgctgagaagagagaaatagaggaaaag
ttgcacaaactcttcagccaagaccacctagtgatatataagggatatgttgatgatcct
cgaaacactgataatgcatggatggagacagaagctgtgaactaccatgacgaaacaggt
gagataatggataatcttatgctagaagctggagatgatgctggaaaagtgaaatgggtg
gacatcaatgataaactgaagctttatgccagtcactctcaattcatcaaacttgtggct
gagaaacgagatgcacactggagcgaggactctgaagctgactgccatgcgttgtag

DBGET integrated database retrieval system