KEGG   Homo sapiens (human): 53346Help
Entry
53346             CDS       T01001                                 

Gene name
TM6SF1
Definition
(RefSeq) transmembrane 6 superfamily member 1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q9BZW5(Tdark)
UniProt: 
Position
15q25.2
AA seq 370 aa AA seqDB search
MSASAATGVFVLSLSAIPVTYVFNHLAAQHDSWTIVGVAALILFLVALLARVLVKRKPPR
DPLFYVYAVFGFTSVVNLIIGLEQDGIIDGFMTHYLREGEPYLNTAYGHMICYWDGSAHY
LMYLVMVAAIAWEETYRTIGLYWVGSIIMSVVVFVPGNIVGKYGTRICPAFFLSIPYTCL
PVWAGFRIYNQPSENYNYPSKVIQEAQAKDLLRRPFDLMLVVCLLLATGFCLFRGLIALD
CPSELCRLYTQFQEPYLKDPAAYPKIQMLAYMFYSVPYFVTALYGLVVPGCSWMPDITLI
HAGGLAQAQFSHIGASLHARTAYVYRVPEEAKILFLALNIAYGVLPQLLAYRCIYKPEFF
IKTKAEEKVE
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcctctgcggccaccggggtcttcgtgctgtccctctcggccatcccggtcacc
tatgtcttcaaccacctggcggcccagcatgattcctggactattgtaggggttgctgcc
ctcatcctgttcctggtagcactgctggctcgtgtcctcgtcaaaagaaaaccaccccgg
gacccactgttctatgtgtatgcagtttttggatttaccagcgtggtgaacctcatcata
ggactggagcaagatggaatcattgacgggttcatgacacactacttgagagagggtgaa
ccgtatctgaacaccgcatatgggcacatgatctgctactgggatggctctgctcattat
ctgatgtacctggtgatggtggcagccatagcatgggaggaaacttatagaaccattggc
ctatattgggttggatctattattatgagtgttgttgtttttgtgccaggaaacattgta
gggaagtatggaacacgaatttgccctgcttttttcttaagcataccatatacttgtctt
cctgtctgggctggtttcagaatctataatcagccatcagaaaattataattacccctca
aaggttattcaagaagcccaagcgaaagacctgctgagaagaccatttgatttaatgttg
gttgtgtgtctcctcctggcaactggattttgcctgttcagaggtttgattgctttggat
tgcccatctgagctctgccgattatatacgcaatttcaagagccctatctaaaggatcct
gctgcttatcctaaaattcagatgctggcatatatgttctattctgttccttactttgtg
actgcactgtatggcttagtggttcctggatgttcctggatgcctgacatcacattgata
catgctggaggtctggctcaggctcagttttctcacattggtgcatctcttcatgctaga
actgcttatgtctacagagtccctgaagaagcaaaaatcctttttttagcattaaacata
gcatatggagttcttcctcagctcttggcctatcgttgtatctacaaaccagagttcttc
ataaaaacaaaggcagaagaaaaagtggaataa

DBGET integrated database retrieval system