KEGG   Homo sapiens (human): 5337Help
Entry
5337              CDS       T01001                                 

Gene name
PLD1
Definition
(RefSeq) phospholipase D1 (EC:3.1.4.4)
  KO
K01115  
phospholipase D1/2 [EC:3.1.4.4]
Organism
hsa  Homo sapiens (human)
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Metabolic pathways
Ras signaling pathway
cAMP signaling pathway
Sphingolipid signaling pathway
Phospholipase D signaling pathway
Endocytosis
Fc gamma R-mediated phagocytosis
Glutamatergic synapse
GnRH signaling pathway
Pathways in cancer
Pancreatic cancer
Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    5337 (PLD1)
   00565 Ether lipid metabolism
    5337 (PLD1)
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    5337 (PLD1)
   04072 Phospholipase D signaling pathway
    5337 (PLD1)
   04071 Sphingolipid signaling pathway
    5337 (PLD1)
   04024 cAMP signaling pathway
    5337 (PLD1)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    5337 (PLD1)
 Organismal Systems
  Immune system
   04666 Fc gamma R-mediated phagocytosis
    5337 (PLD1)
  Endocrine system
   04912 GnRH signaling pathway
    5337 (PLD1)
  Nervous system
   04724 Glutamatergic synapse
    5337 (PLD1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    5337 (PLD1)
   05231 Choline metabolism in cancer
    5337 (PLD1)
   05212 Pancreatic cancer
    5337 (PLD1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.4  phospholipase D
     5337 (PLD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3q26
AA seq 1074 aa AA seqDB search
MSLKNEPRVNTSALQKIAADMSNIIENLDTRELHFEGEEVDYDVSPSDPKIQEVYIPFSA
IYNTQGFKEPNIQTYLSGCPIKAQVLEVERFTSTTRVPSINLYTIELTHGEFKWQVKRKF
KHFQEFHRELLKYKAFIRIPIPTRRHTFRRQNVREEPREMPSLPRSSENMIREEQFLGRR
KQLEDYLTKILKMPMYRNYHATTEFLDISQLSFIHDLGPKGIEGMIMKRSGGHRIPGLNC
CGQGRACYRWSKRWLIVKDSFLLYMKPDSGAIAFVLLVDKEFKIKVGKKETETKYGIRID
NLSRTLILKCNSYRHARWWGGAIEEFIQKHGTNFLKDHRFGSYAAIQENALAKWYVNAKG
YFEDVANAMEEANEEIFITDWWLSPEIFLKRPVVEGNRWRLDCILKRKAQQGVRIFIMLY
KEVELALGINSEYTKRTLMRLHPNIKVMRHPDHVSSTVYLWAHHEKLVIIDQSVAFVGGI
DLAYGRWDDNEHRLTDVGSVKRVTSGPSLGSLPPAAMESMESLRLKDKNEPVQNLPIQKS
IDDVDSKLKGIGKPRKFSKFSLYKQLHRHHLHDADSISSIDSTSSYFNHYRSHHNLIHGL
KPHFKLFHPSSESEQGLTRPHADTGSIRSLQTGVGELHGETRFWHGKDYCNFVFKDWVQL
DKPFADFIDRYSTPRMPWHDIASAVHGKAARDVARHFIQRWNFTKIMKSKYRSLSYPFLL
PKSQTTAHELRYQVPGSVHANVQLLRSAADWSAGIKYHEESIHAAYVHVIENSRHYIYIE
NQFFISCADDKVVFNKIGDAIAQRILKAHRENQKYRVYVVIPLLPGFEGDISTGGGNALQ
AIMHFNYRTMCRGENSILGQLKAELGNQWINYISFCGLRTHAELEGNLVTELIYVHSKLL
IADDNTVIIGSANINDRSMLGKRDSEMAVIVQDTETVPSVMDGKEYQAGRFARGLRLQCF
RVVLGYLDDPSEDIQDPVSDKFFKEVWVSTAARNATIYDKVFRCLPNDEVHNLIQLRDFI
NKPVLAKEDPIRAEEELKKIRGFLVQFPFYFLSEESLLPSVGTKEAIVPMEVWT
NT seq 3225 nt NT seq  +upstreamnt  +downstreamnt
atgtcactgaaaaacgagccacgggtaaatacctctgcactgcagaaaattgctgctgac
atgagtaatatcatagaaaatctggacacgcgggaactccactttgagggagaggaggta
gactacgacgtgtctcccagcgatcccaagatacaagaagtgtatatccctttctctgct
atttataacactcaaggatttaaggagcctaatatacagacgtatctctccggctgtcca
ataaaagcacaagttctggaagtggaacgcttcacatctacaacaagggtaccaagtatt
aatctttacactattgaattaacacatggggaatttaaatggcaagttaagaggaaattc
aagcattttcaagaatttcacagagagctgctcaagtacaaagcctttatccgcatcccc
attcccactagaagacacacgtttaggaggcaaaacgtcagagaggagcctcgagagatg
cccagtttgccccgttcatctgaaaacatgataagagaagaacaattccttggtagaaga
aaacaactggaagattacttgacaaagatactaaaaatgcccatgtatagaaactatcat
gccacaacagagtttcttgatataagccagctgtctttcatccatgatttgggaccaaag
ggcatagaaggtatgataatgaaaagatctggaggacacagaataccaggcttgaattgc
tgtggtcagggaagagcctgctacagatggtcaaaaagatggttaatagtgaaagattcc
tttttattgtatatgaaaccagacagcggtgccattgccttcgtcctgctggtagacaaa
gaattcaaaattaaggtggggaagaaggagacagaaacgaaatatggaatccgaattgat
aatctttcaaggacacttattttaaaatgcaacagctatagacatgctcggtggtgggga
ggggctatagaagaattcatccagaaacatggcaccaactttctcaaagatcatcgattt
gggtcatatgctgctatccaagagaatgctttagctaaatggtatgttaatgccaaagga
tattttgaagatgtggcaaatgcaatggaagaggcaaatgaagagatttttatcacagac
tggtggctgagtccagaaatcttcctgaaacgcccagtggttgagggaaatcgttggagg
ttggactgcattcttaaacgaaaagcacaacaaggagtgaggatcttcataatgctctac
aaagaggtggaactcgctcttggcatcaatagtgaatacaccaagaggactttgatgcgt
ctacatcccaacataaaggtgatgagacacccggatcatgtgtcatccaccgtctatttg
tgggctcaccatgagaagcttgtcatcattgaccaatcggtggcctttgtgggagggatt
gacctggcctatggaaggtgggacgacaatgagcacagactcacagacgtgggcagtgtg
aagcgggtcacttcaggaccgtctctgggttccctcccacctgccgcaatggagtctatg
gaatccttaagactcaaagataaaaatgagcctgttcaaaacctacccatccagaagagt
attgatgatgtggattcaaaactgaaaggaataggaaagccaagaaagttctccaaattt
agtctctacaagcagctccacaggcaccacctgcacgacgcagatagcatcagcagcatt
gacagcacctccagttattttaatcactatagaagtcatcacaatttaatccatggttta
aaaccccacttcaaactctttcacccgtccagtgagtctgagcaaggactcactagacct
catgctgataccgggtccatccgtagtttacagacaggtgtgggagagctgcatggggaa
accagattctggcatggaaaggactactgcaatttcgtcttcaaagactgggttcaactt
gataaaccttttgctgatttcattgacaggtactccacgccccggatgccctggcatgac
attgcctctgcagtccacgggaaggcggctcgtgatgtggcacgtcacttcatccagcgc
tggaacttcacaaaaattatgaaatcaaaatatcggtccctttcttatccttttctgctt
ccaaagtctcaaacaacagcccatgagttgagatatcaagtgcctgggtctgtccatgct
aacgtacagttgctccgctctgctgctgattggtctgctggtataaagtaccatgaagag
tccatccacgccgcttacgtccatgtgatagagaacagcaggcactatatctatatcgaa
aaccagtttttcataagctgtgctgatgacaaagttgtgttcaacaagataggcgatgcc
attgcccagaggatcctgaaagctcacagggaaaaccagaaataccgggtatatgtcgtg
ataccacttctgccagggttcgaaggagacatttcaaccggcggaggaaatgctctacag
gcaatcatgcacttcaactacagaaccatgtgcagaggagaaaattccatccttggacag
ttaaaagcagagcttggtaatcagtggataaattacatatcattctgtggtcttagaaca
catgcagagctcgaaggaaacctagtaactgagcttatctatgtccacagcaagttgtta
attgctgatgataacactgttattattggctctgccaacataaatgaccgcagcatgctg
ggaaagcgtgacagtgaaatggctgtcattgtgcaagatacagagactgttccttcagta
atggatggaaaagagtaccaagctggccggtttgcccgaggacttcggctacagtgcttt
agggttgtccttggctatcttgatgacccaagtgaggacattcaggatccagtgagtgac
aaattcttcaaggaggtgtgggtttcaacagcagctcgaaatgctacaatttatgacaag
gttttccggtgccttcccaatgatgaagtacacaatttaattcagctgagagactttata
aacaagcccgtattagctaaggaagatcccattcgagctgaggaggaactgaagaagatc
cgtggatttttggtgcaattccccttttatttcttgtctgaagaaagcctactgccttct
gttgggaccaaagaggccatagtgcccatggaggtttggacttaa

DBGET integrated database retrieval system