KEGG   Homo sapiens (human): 53373Help
Entry
53373             CDS       T01001                                 

Gene name
TPCN1, TPC1
Definition
(RefSeq) two pore segment channel 1
  KO
K16896  
two pore calcium channel protein 1
Organism
hsa  Homo sapiens (human)
Brite
Ion channels [BR:hsa04040]
 Related to voltage-gated cation channels
  CatSper and two-pore channel
   53373 (TPCN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
12q24.13
AA seq 816 aa AA seqDB search
MAVSLDDDVPLILTLDEGGSAPLAPSNGLGQEELPSKNGGSYAIHDSQAPSLSSGGESSP
SSPAHNWEMNYQEAAIYLQEGENNDKFFTHPKDAKALAAYLFAHNHLFYLMELATALLLL
LLSLCEAPAVPALRLGIYVHATLELFALMVVVFELCMKLRWLGLHTFIRHKRTMVKTSVL
VVQFVEAIVVLVRQMSHVRVTRALRCIFLVDCRYCGGVRRNLRQIFQSLPPFMDILLLLL
FFMIIFAILGFYLFSPNPSDPYFSTLENSIVSLFVLLTTANFPDVMMPSYSRNPWSCVFF
IVYLSIELYFIMNLLLAVVFDTFNDIEKRKFKSLLLHKRTAIQHAYRLLISQRRPAGISY
RQFEGLMRFYKPRMSARERYLTFKALNQNNTPLLSLKDFYDIYEVAALKWKAKKNREHWF
DELPRTALLIFKGINILVKSKAFQYFMYLVVAVNGVWILVETFMLKGGNFFSKHVPWSYL
VFLTIYGVELFLKVAGLGPVEYLSSGWNLFDFSVTVFAFLGLLALALNMEPFYFIVVLRP
LQLLRLFKLKERYRNVLDTMFELLPRMASLGLTLLIFYYSFAIVGMEFFCGIVFPNCCNT
STVADAYRWRNHTVGNRTVVEEGYYYLNNFDNILNSFVTLFELTVVNNWYIIMEGVTSQT
SHWSRLYFMTFYIVTMVVMTIIVAFILEAFVFRMNYSRKNQDSEVDGGITLEKEISKEEL
VAVLELYREARGASSDVTRLLETLSQMERYQQHSMVFLGRRSRTKSDLSLKMYQEEIQEW
YEEHAREQEQQRQLSSSAAPAAQQPPGSRQRSQTVT
NT seq 2451 nt NT seq  +upstreamnt  +downstreamnt
atggctgtgagtttggatgacgacgtgccgctcatcctgaccttggatgagggtggcagt
gccccactggctccctccaacggcctgggccaagaagagctacctagcaaaaatggcggc
agctatgccatccacgactcccaggcccccagtctcagctctgggggtgagagttccccc
tccagccccgcacacaactgggagatgaattaccaagaggcagcaatctacctccaggaa
ggcgagaacaacgacaagttcttcacccaccccaaggatgccaaggcgctggcggcctac
ctctttgcacacaatcacctcttctacctgatggagctggccacggccctgctgctgctg
ctgctctccctgtgcgaggcccccgccgtccccgcactccggcttggcatctatgtccac
gccaccctggagctgtttgccctgatggtggtagtgtttgaactctgcatgaagttacgc
tggctgggcctccacaccttcatccggcacaagcggaccatggtcaagacctcggtgctg
gtggtgcagtttgtcgaggccatcgtggtgttggtacggcagatgtcccatgtgcgggtg
acccgagcactgcgctgcattttcctggtggactgtcggtattgcggtggcgtccggcgc
aacctgcggcagatcttccagtccctgccgcccttcatggacatcctcctgctgctgctg
ttcttcatgatcatctttgccatcctcggtttctacttgttctcccctaacccttcagac
ccctacttcagcaccctggagaacagcatcgtcagtctgtttgtccttctgaccacagcc
aatttcccagatgtgatgatgccctcctactcccggaacccctggtcctgcgtcttcttc
atcgtgtacctctccatcgagctgtatttcatcatgaacctgcttctggctgtggtgttc
gacaccttcaatgacattgagaaacgcaagttcaagtctttgctactgcacaagcgaacc
gctatccagcatgcctaccgcctgctcatcagccagaggaggcctgccggcatctcctac
aggcagtttgaaggcctcatgcgcttctacaagccccggatgagtgccagggagcgctat
cttaccttcaaggccctgaatcagaacaacacacccctgctcagcctaaaggacttttac
gatatctacgaagttgctgctttgaagtggaaggccaagaaaaacagagagcactggttt
gatgagcttcccaggacggcgctcctcatcttcaaaggtattaatatccttgtgaagtcc
aaggccttccagtatttcatgtacttggtggtggcagtcaacggggtctggatcctcgtg
gagacatttatgctgaaaggtgggaacttcttctccaagcacgtgccctggagttacctc
gtctttctaactatctatggggtggagctgttcctgaaggttgccggcctgggccctgtg
gagtacttgtcttccggatggaacttgtttgacttctccgtgacagtgttcgccttcctg
ggactgctggcgctggccctcaacatggagcccttctatttcatcgtggtcctgcgcccc
ctccagctgctgaggttgtttaagttgaaggagcgctaccgcaacgtgctggacaccatg
ttcgagctgctgccccggatggccagcctgggcctcaccctgctcatcttttactactcc
ttcgccatcgtgggcatggagttcttctgcgggatcgtcttccccaactgctgcaacacg
agtacagtggcagatgcctaccgctggcgcaaccacaccgtgggcaacaggaccgtggtg
gaggaaggctactattatctcaataattttgacaacatcctcaacagctttgtgaccctg
tttgagctcacagttgtcaacaactggtacatcatcatggaaggcgtcacctctcagacc
tcccactggagccgcctctacttcatgaccttttacattgtgaccatggtggtgatgacg
atcattgtcgcctttatcctcgaggccttcgtcttccgaatgaactacagccgcaagaac
caggactcggaagttgatggtggcatcacccttgagaaggaaatctccaaagaagagctg
gttgccgtcctggagctctaccgggaggcacggggggcctcctcggatgtcaccaggctg
ctggagaccctctcccagatggagagataccagcaacattccatggtgtttctgggacgg
cgatcaaggaccaagagcgacctgagcctgaagatgtaccaggaggagatccaggagtgg
tatgaggagcatgccagggagcaagagcagcagcgacaactcagcagcagtgcagccccc
gccgcccagcagcccccaggcagccgccagcgctcccagaccgttacctag

DBGET integrated database retrieval system