KEGG   Homo sapiens (human): 5338Help
Entry
5338              CDS       T01001                                 

Gene name
PLD2, PLD1C
Definition
(RefSeq) phospholipase D2
  KO
K01115  
phospholipase D1/2 [EC:3.1.4.4]
Organism
hsa  Homo sapiens (human)
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Metabolic pathways
Ras signaling pathway
cAMP signaling pathway
Sphingolipid signaling pathway
Phospholipase D signaling pathway
Endocytosis
Fc gamma R-mediated phagocytosis
Glutamatergic synapse
GnRH signaling pathway
Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    5338 (PLD2)
   00565 Ether lipid metabolism
    5338 (PLD2)
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    5338 (PLD2)
   04072 Phospholipase D signaling pathway
    5338 (PLD2)
   04071 Sphingolipid signaling pathway
    5338 (PLD2)
   04024 cAMP signaling pathway
    5338 (PLD2)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    5338 (PLD2)
 Organismal Systems
  Immune system
   04666 Fc gamma R-mediated phagocytosis
    5338 (PLD2)
  Endocrine system
   04912 GnRH signaling pathway
    5338 (PLD2)
  Nervous system
   04724 Glutamatergic synapse
    5338 (PLD2)
 Human Diseases
  Cancers
   05231 Choline metabolism in cancer
    5338 (PLD2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.4  phospholipase D
     5338 (PLD2)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    5338 (PLD2)
 Endosome - Golgi transport
  Others
   Others
    5338 (PLD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
O14939(Tchem)
UniProt: 
Position
17p13.2
AA seq 933 aa AA seqDB search
MTATPESLFPTGDELDSSQLQMESDEVDTLKEGEDPADRMHPFLAIYELQSLKVHPLVFA
PGVPVTAQVVGTERYTSGSKVGTCTLYSVRLTHGDFSWTTKKKYRHFQELHRDLLRHKVL
MSLLPLARFAVAYSPARDAGNREMPSLPRAGPEGSTRHAASKQKYLENYLNRLLTMSFYR
NYHAMTEFLEVSQLSFIPDLGRKGLEGMIRKRSGGHRVPGLTCCGRDQVCYRWSKRWLVV
KDSFLLYMCLETGAISFVQLFDPGFEVQVGKRSTEARHGVRIDTSHRSLILKCSSYRQAR
WWAQEITELAQGPGRDFLQLHRHDSYAPPRPGTLARWFVNGAGYFAAVADAILRAQEEIF
ITDWWLSPEVYLKRPAHSDDWRLDIMLKRKAEEGVRVSILLFKEVELALGINSGYSKRAL
MLLHPNIKVMRHPDQVTLWAHHEKLLVVDQVVAFLGGLDLAYGRWDDLHYRLTDLGDSSE
SAASQPPTPRPDSPATPDLSHNQFFWLGKDYSNLITKDWVQLDRPFEDFIDRETTPRMPW
RDVGVVVHGLPARDLARHFIQRWNFTKTTKAKYKTPTYPYLLPKSTSTANQLPFTLPGGQ
CTTVQVLRSVDRWSAGTLENSILNAYLHTIRESQHFLYIENQFFISCSDGRTVLNKVGDE
IVDRILKAHKQGWCYRVYVLLPLLPGFEGDISTGGGNSIQAILHFTYRTLCRGEYSILHR
LKAAMGTAWRDYISICGLRTHGELGGHPVSELIYIHSKVLIADDRTVIIGSANINDRSLL
GKRDSELAVLIEDTETEPSLMNGAEYQAGRFALSLRKHCFGVILGANTRPDLDLRDPICD
DFFQLWQDMAESNANIYEQIFRCLPSNATRSLRTLREYVAVEPLATVSPPLARSELTQVQ
GHLVHFPLKFLEDESLLPPLGSKEGMIPLEVWT
NT seq 2802 nt NT seq  +upstreamnt  +downstreamnt
atgacggcgacccctgagagcctcttccccactggggacgaactggactccagccagctc
cagatggagtccgatgaggtggacaccctgaaggagggagaggacccagccgaccggatg
cacccgtttctggccatctatgagcttcagtctctgaaagtgcaccccttggtgttcgca
cctggggtccctgtcacagcccaggtggtgggcaccgaaagatataccagcggatccaag
gtgggaacctgcactctgtattctgtccgcttgactcacggcgacttttcctggacaacc
aagaagaaataccgtcattttcaggagctgcatcgggacctcctgagacacaaagtcttg
atgagtctgctccctctggctcgatttgccgttgcctattctccagcccgagatgcaggc
aacagagagatgccctctctaccccgggcaggtcctgagggctccaccagacatgcagcc
agcaaacagaaatacctggagaattacctcaaccgtctcttgaccatgtctttctatcgc
aactaccatgccatgacagagttcctggaagtcagtcagctgtcctttatcccggacttg
ggccgcaaaggactggaggggatgatccggaagcgctcaggtggccaccgtgttcctggc
ctcacctgctgtggccgagaccaagtttgttatcgctggtccaagaggtggctggtggtg
aaggactccttcctgctgtacatgtgcctcgagacaggtgccatctcatttgttcagctc
tttgaccctggctttgaggtgcaagtggggaaaaggagcacggaggcacggcacggcgtg
cggatcgatacctcccacaggtccttgattctcaagtgcagcagctaccggcaggcacgg
tggtgggcccaagagatcactgagctggcacagggcccaggcagagacttcctacagctg
caccggcatgacagctacgccccaccccggcctgggaccttggcccggtggtttgtgaat
ggggcaggttactttgctgctgtggcagatgccatccttcgagctcaagaggagattttc
atcacagactggtggttgagtcctgaggtttacctgaagcgtccggcccattcagatgac
tggagactggacattatgctcaagaggaaggcggaggagggtgtccgtgtgtctattctg
ctgtttaaagaagtggaattggccttgggcatcaacagtggctatagcaagagggcgctg
atgctgctgcaccccaacataaaggtgatgcgtcacccagaccaagtgacgttgtgggcc
catcatgagaagctcctggtggtggaccaagtggtagcattcctggggggactggacctt
gcctatggccgctgggatgacctgcactaccgactgactgaccttggagactcctctgaa
tcagctgcctcccagcctcccaccccgcgcccagactcaccagccaccccagacctctct
cacaaccaattcttctggctgggcaaggactacagcaatcttatcaccaaggactgggtg
cagctggaccggcctttcgaagatttcattgacagggagacgacccctcggatgccatgg
cgggacgttggggtggtcgtccatggcctaccggcccgggaccttgcccggcacttcatc
cagcgctggaacttcaccaagaccaccaaggccaagtacaagactcccacatacccctac
ctgcttcccaagtctaccagcacggccaatcagctccccttcacacttccaggagggcag
tgcaccaccgtacaggtcttgcgatcagtggaccgctggtcagcagggactctggagaac
tccatcctcaatgcctacctgcacaccatcagggagagccagcacttcctctacattgag
aatcagttcttcattagctgctcagatgggcggacggttctgaacaaggtgggcgatgag
attgtggacagaatcctgaaggcccacaaacaggggtggtgttaccgagtctacgtgctt
ttgcccttactccctggcttcgagggtgacatctccacgggcggtggcaactccatccag
gccattctgcactttacttacaggaccctgtgtcgtggggagtattcaatcctgcatcgc
cttaaagcagccatggggacagcatggcgggactatatttccatctgcgggcttcgtaca
cacggagagctgggcgggcaccccgtctcggagctcatctacatccacagcaaggtgctc
atcgcagatgaccggacagtcatcattggttctgcaaacatcaatgaccggagcttgctg
gggaagcgggacagtgagctggccgtgctgatcgaggacacagagacggaaccatccctc
atgaatggggcagagtatcaggcgggcaggtttgccttgagtctgcggaagcactgcttc
ggtgtgattcttggagcaaatacccggccagacttggatctccgagaccccatctgtgat
gacttcttccagttgtggcaagacatggctgagagcaacgccaatatctatgagcagatc
ttccgctgcctgccatccaatgccacgcgttccctgcggactctccgggagtacgtggcc
gtggagcccttggccacggtcagtccccccttggctcggtctgagctcacccaggtccag
ggccacctggtccacttccccctcaagttcctagaggatgagtctttgctgcccccgctg
ggtagcaaggagggcatgatccccctagaagtgtggacatag

DBGET integrated database retrieval system