KEGG   Homo sapiens (human): 53405Help
Entry
53405             CDS       T01001                                 

Gene name
CLIC5, DFNB102, DFNB103, MST130, MSTP130
Definition
(RefSeq) chloride intracellular channel 5
  KO
K05025  
chloride intracellular channel protein 5
Organism
hsa  Homo sapiens (human)
Brite
Ion channels [BR:hsa04040]
 Chloride channels
  Chloride intracellular channel
   53405 (CLIC5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
6p12.3
AA seq 410 aa AA seqDB search
MNDEDYSTIYDTIQNERTYEVPDQPEENESPHYDDVHEYLRPENDLYATQLNTHEYDFVS
VYTIKGEETSLASVQSEDRGYLLPDEIYSELQEAHPGEPQEDRGISMEGLYSSTQDQQLC
AAELQENGSVMKEDLPSPSSFTIQHSKAFSTTKYSCYSDAEGLEEKEGAHMNPEIYLFVK
AGIDGESIGNCPFSQRLFMILWLKGVVFNVTTVDLKRKPADLHNLAPGTHPPFLTFNGDV
KTDVNKIEEFLEETLTPEKYPKLAAKHRESNTAGIDIFSKFSAYIKNTKQQNNAALERGL
TKALKKLDDYLNTPLPEEIDANTCGEDKGSRRKFLDGDELTLADCNLLPKLHVVKIVAKK
YRNYDIPAEMTGLWRYLKNAYARDEFTNTCAADSEIELAYADVAKRLSRS
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgaatgacgaagactacagcaccatctatgacacaatccaaaatgagaggacgtatgag
gttccagaccagccagaagaaaatgaaagtccccattatgatgatgtccatgagtactta
aggccagaaaatgatttatatgccactcagctgaatacccatgagtatgattttgtgtca
gtctataccattaagggtgaagagaccagcttggcctctgtccagtcagaagacagaggc
tacctcctgcctgatgagatatactctgaactccaggaggctcatccaggtgagccccag
gaggacaggggcatctcaatggaagggttatattcatcaacccaggaccagcaactctgc
gcagcagaactccaggagaatgggagtgtgatgaaggaagatctgccttctccttcaagc
ttcaccattcagcacagtaaggccttctctaccaccaagtattcctgctattctgatgct
gaaggtttggaagaaaaggagggagctcacatgaaccctgagatttacctctttgtgaag
gctggaatcgatggagaaagcatcggcaactgtcctttctctcagcgcctcttcatgatc
ctctggctgaaaggagtcgtgttcaatgtcaccactgtggatctgaaaagaaagccagct
gacctgcacaacctagcccccggcacgcacccgcccttcctgaccttcaacggggacgtg
aagacagacgtcaataagatcgaggagttcctggaggagaccttgacccctgaaaagtac
cccaaactggctgcaaaacaccgggaatccaacacagcgggcatcgacatcttttccaag
ttttctgcctacatcaaaaataccaagcagcagaacaatgctgctcttgaaagaggccta
accaaggctctaaagaaattggatgactacctgaacacccctctaccagaggagattgac
gccaacacttgtggggaagacaaggggtcccggcgcaagttcctggatggggatgagctg
accctggctgactgcaatctgttgcccaagctccatgtggtcaagattgtggccaagaaa
taccgcaactatgatatcccggctgagatgacaggcctgtggcggtacctcaagaacgcc
tatgcccgtgatgagttcaccaacacctgtgcagctgacagtgagatcgagttggcctac
gctgatgtcgccaaacgcctcagccgatcctga

DBGET integrated database retrieval system