KEGG   Homo sapiens (human): 53405Help
Entry
53405             CDS       T01001                                 

Gene name
CLIC5, DFNB102, DFNB103, MST130, MSTP130
Definition
(RefSeq) chloride intracellular channel 5
  KO
K05025  chloride intracellular channel protein 5
Organism
hsa  Homo sapiens (human)
Brite
Ion channels [BR:hsa04040]
 Chloride channels
  Chloride intracellular channel
   53405 (CLIC5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_C_2 GST_N_3 GST_N_2 GST_C GST_C_3 GST_C_5
Motif
Other DBs
NCBI-GeneID: 53405
NCBI-ProteinID: NP_001107558
OMIM: 607293
HGNC: 13517
Ensembl: ENSG00000112782
Vega: OTTHUMG00000014775
Pharos: Q9NZA1(Tbio)
UniProt: Q9NZA1 Q53G01
Position
6p21.1
AA seq 410 aa AA seqDB search
MNDEDYSTIYDTIQNERTYEVPDQPEENESPHYDDVHEYLRPENDLYATQLNTHEYDFVS
VYTIKGEETSLASVQSEDRGYLLPDEIYSELQEAHPGEPQEDRGISMEGLYSSTQDQQLC
AAELQENGSVMKEDLPSPSSFTIQHSKAFSTTKYSCYSDAEGLEEKEGAHMNPEIYLFVK
AGIDGESIGNCPFSQRLFMILWLKGVVFNVTTVDLKRKPADLHNLAPGTHPPFLTFNGDV
KTDVNKIEEFLEETLTPEKYPKLAAKHRESNTAGIDIFSKFSAYIKNTKQQNNAALERGL
TKALKKLDDYLNTPLPEEIDANTCGEDKGSRRKFLDGDELTLADCNLLPKLHVVKIVAKK
YRNYDIPAEMTGLWRYLKNAYARDEFTNTCAADSEIELAYADVAKRLSRS
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgaatgacgaagactacagcaccatctatgacacaatccaaaatgagaggacgtatgag
gttccagaccagccagaagaaaatgaaagtccccattatgatgatgtccatgagtactta
aggccagaaaatgatttatatgccactcagctgaatacccatgagtatgattttgtgtca
gtctataccattaagggtgaagagaccagcttggcctctgtccagtcagaagacagaggc
tacctcctgcctgatgagatatactctgaactccaggaggctcatccaggtgagccccag
gaggacaggggcatctcaatggaagggttatattcatcaacccaggaccagcaactctgc
gcagcagaactccaggagaatgggagtgtgatgaaggaagatctgccttctccttcaagc
ttcaccattcagcacagtaaggccttctctaccaccaagtattcctgctattctgatgct
gaaggtttggaagaaaaggagggagctcacatgaaccctgagatttacctctttgtgaag
gctggaatcgatggagaaagcatcggcaactgtcctttctctcagcgcctcttcatgatc
ctctggctgaaaggagtcgtgttcaatgtcaccactgtggatctgaaaagaaagccagct
gacctgcacaacctagcccccggcacgcacccgcccttcctgaccttcaacggggacgtg
aagacagacgtcaataagatcgaggagttcctggaggagaccttgacccctgaaaagtac
cccaaactggctgcaaaacaccgggaatccaacacagcgggcatcgacatcttttccaag
ttttctgcctacatcaaaaataccaagcagcagaacaatgctgctcttgaaagaggccta
accaaggctctaaagaaattggatgactacctgaacacccctctaccagaggagattgac
gccaacacttgtggggaagacaaggggtcccggcgcaagttcctggatggggatgagctg
accctggctgactgcaatctgttgcccaagctccatgtggtcaagattgtggccaagaaa
taccgcaactatgatatcccggctgagatgacaggcctgtggcggtacctcaagaacgcc
tatgcccgtgatgagttcaccaacacctgtgcagctgacagtgagatcgagttggcctac
gctgatgtcgccaaacgcctcagccgatcctga

DBGET integrated database retrieval system