KEGG   Homo sapiens (human): 53407Help
Entry
53407             CDS       T01001                                 

Gene name
STX18, Ufe1
Definition
syntaxin 18
Orthology
K08492  
syntaxin 18
Organism
hsa  Homo sapiens (human)
Pathway
SNARE interactions in vesicular transport
Phagosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    53407 (STX18)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    53407 (STX18)
SNAREs [BR:hsa04131]
 Syntaxin (Qa)
  Stx-rER
   53407 (STX18)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
4p16.3-p16.2
AA seq 335 aa AA seqDB search
MAVDITLLFRASVKTVKTRNKALGVAVGGGVDGSRDELFRRSPRPKGDFSSRAREVISHI
GKLRDFLLEHRKDYINAYSHTMSEYGRMTDTERDQIDQDAQIFMRTCSEAIQQLRTEAHK
EIHSQQVKEHRTAVLDFIEDYLKRVCKLYSEQRAIRVKRVVDKKRLSKLEPEPNTKTRES
TSSEKVSQSPSKDSEENPATEERPEKILAETQPELGTWGDGKGEDELSPEEIQMFEQENQ
RLIGEMNSLFDEVRQIEGRVVEISRLQEIFTEKVLQQEAEIDSIHQLVVGATENIKEGNE
DIREAIKNNAGFRVWILFFLVMCSFSLLFLDWYDS
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atggcggtggacatcacgctgctattccgggccagcgtcaagaccgtgaagacgcggaac
aaggcgctgggagtggcggtgggcggcggggtcgatggcagccgggacgagctgttccgc
cggagcccccggcccaagggcgacttctccagccgggcccgcgaagtgatttctcacatt
ggcaaactgagagattttcttctggaacacaggaaagattatattaatgcttatagccat
accatgtctgaatatgggaggatgacagacacagaacgagaccagatagaccaggatgcc
cagatattcatgaggacctgttcagaagcaattcagcaactacgaacagaagctcacaag
gagatacattcccagcaagtgaaggagcacaggaccgctgttttggatttcattgaagat
tacttgaaaagagtatgtaaactttactcagaacagagagccatccgagttaaaagagtg
gtggataagaaaagattatctaagctggaaccagaaccaaatacaaagacaagagaatcc
acatcttctgagaaagtttcacagagtccttcaaaagactctgaagaaaaccctgccact
gaagaacgtccagaaaaaattttggctgaaacacaacctgaattgggaacgtggggagat
ggcaaaggcgaagatgagttatccccagaagaaatacaaatgtttgaacaggaaaatcag
cgactaattggtgaaatgaacagcttgtttgatgaagtgaggcaaatcgaagggagagtg
gttgagatttccagactccaagagatattcacggaaaaggttttgcaacaggaagctgag
attgacagcattcaccagttagttgtgggggcaactgaaaatatcaaggaaggcaacgaa
gacataagagaggccattaaaaacaacgctggcttccgcgtgtggatcctcttcttcctc
gtgatgtgctccttctccttgctcttcctcgactggtacgacagctag

DBGET integrated database retrieval system