KEGG   Homo sapiens (human): 5345Help
Entry
5345              CDS       T01001                                 

Gene name
SERPINF2, A2AP, AAP, ALPHA-2-PI, API, PLI
Definition
(RefSeq) serpin family F member 2
  KO
K03983  alpha-2-antiplasmin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04610  Complement and coagulation cascades
Disease
H00983  Alpha-2-plasmin inhibitor (a2-PI) deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04610 Complement and coagulation cascades
    5345 (SERPINF2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Serpin
Motif
Other DBs
NCBI-GeneID: 5345
NCBI-ProteinID: NP_000925
OMIM: 613168
HGNC: 9075
Ensembl: ENSG00000167711
Vega: OTTHUMG00000090552
Pharos: P08697(Tbio)
UniProt: P08697
Position
17p13.3
AA seq 491 aa AA seqDB search
MALLWGLLVLSWSCLQGPCSVFSPVSAMEPLGRQLTSGPNQEQVSPLTLLKLGNQEPGGQ
TALKSPPGVCSRDPTPEQTHRLARAMMAFTADLFSLVAQTSTCPNLILSPLSVALALSHL
ALGAQNHTLQRLQQVLHAGSGPCLPHLLSRLCQDLGPGAFRLAARMYLQKGFPIKEDFLE
QSEQLFGAKPVSLTGKQEDDLANINQWVKEATEGKIQEFLSGLPEDTVLLLLNAIHFQGF
WRNKFDPSLTQRDSFHLDEQFTVPVEMMQARTYPLRWFLLEQPEIQVAHFPFKNNMSFVV
LVPTHFEWNVSQVLANLSWDTLHPPLVWERPTKVRLPKLYLKHQMDLVATLSQLGLQELF
QAPDLRGISEQSLVVSGVQHQSTLELSEVGVEAAAATSIAMSRMSLSSFSVNRPFLFFIF
EDTTGLPLFVGSVRNPNPSAPRELKEQQDSPGNKDFLQSLKGFPRGDKLFGPDLKLVPPM
EEDYPQFGSPK
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgctctgggggctcctggtgctcagctggtcctgcctgcaaggcccctgctcc
gtgttctcccctgtgagcgccatggagcccttgggccggcagctaactagcgggccgaac
caggagcaggtgtccccacttaccctcctcaagttgggcaaccaggagcctggtggccag
actgccctgaagagtcccccaggagtctgcagcagagaccccaccccagagcagacccac
aggctggcccgggccatgatggccttcactgccgacctgttctccctggtggctcaaacg
tccacctgccccaacctcatcctgtcacccctgagtgtggccctggcgctgtctcacctg
gcactaggtgctcagaaccacacgttgcagaggctgcaacaggtgctgcacgcaggctca
gggccctgcctcccccatctgctgagccgcctctgccaggacctgggccccggcgcgttc
cgactggctgccaggatgtacctgcagaaaggatttcccatcaaagaagatttcctggaa
caatccgaacagctatttggggcaaagcccgtgagcctgacgggaaagcaggaagatgac
ctggcaaacatcaaccaatgggtgaaggaggccacggaggggaagattcaggaattcctc
tctgggctgccggaagacaccgtgttgcttctcctcaacgccatccacttccagggtttc
tggaggaacaagtttgacccgagccttacccagagagactccttccacctggacgagcag
ttcacggtgcccgtggaaatgatgcaggcccgcacgtacccgctgcgctggttcttgctg
gagcagcctgagatccaggtggctcatttcccctttaagaacaacatgagctttgtggtc
cttgtacccacccactttgaatggaacgtgtcccaggtactggccaacctgagttgggac
accctgcacccacctctggtgtgggagaggcccaccaaggtccggctgcctaagctgtat
ctgaaacaccaaatggacctggtggccaccctcagccagctgggcctgcaggagttgttc
caggccccagacctgcgtgggatctccgagcagagcctggtggtgtccggcgtgcagcat
cagtccaccctggagctcagcgaggtcggcgtggaggcggcggcggccaccagcattgcc
atgtcccgcatgtccctgtcctccttcagcgtgaaccgccccttcctcttcttcatcttc
gaggacaccacaggccttcccctcttcgtgggcagcgtgaggaaccccaaccccagtgca
ccgcgggagctcaaggaacagcaggattccccgggcaacaaggacttcctccagagcctg
aaaggcttcccccgcggagacaagcttttcggccctgacttaaaacttgtgccccccatg
gaggaggattacccccagtttggcagccccaagtga

DBGET integrated database retrieval system