KEGG   Homo sapiens (human): 5345Help
Entry
5345              CDS       T01001                                 

Gene name
SERPINF2, A2AP, AAP, ALPHA-2-PI, API, PLI
Definition
(RefSeq) serpin peptidase inhibitor, clade F (alpha-2 antiplasmin, pigment epithelium derived factor), member 2
  KO
K03983  
alpha-2-antiplasmin
Organism
hsa  Homo sapiens (human)
Pathway
Complement and coagulation cascades
Disease
H00983  
Alpha-2-plasmin inhibitor (a2-PI) deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04610 Complement and coagulation cascades
    5345 (SERPINF2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17p13
AA seq 491 aa AA seqDB search
MALLWGLLVLSWSCLQGPCSVFSPVSAMEPLGRQLTSGPNQEQVSPLTLLKLGNQEPGGQ
TALKSPPGVCSRDPTPEQTHRLARAMMAFTADLFSLVAQTSTCPNLILSPLSVALALSHL
ALGAQNHTLQRLQQVLHAGSGPCLPHLLSRLCQDLGPGAFRLAARMYLQKGFPIKEDFLE
QSEQLFGAKPVSLTGKQEDDLANINQWVKEATEGKIQEFLSGLPEDTVLLLLNAIHFQGF
WRNKFDPSLTQRDSFHLDEQFTVPVEMMQARTYPLRWFLLEQPEIQVAHFPFKNNMSFVV
LVPTHFEWNVSQVLANLSWDTLHPPLVWERPTKVRLPKLYLKHQMDLVATLSQLGLQELF
QAPDLRGISEQSLVVSGVQHQSTLELSEVGVEAAAATSIAMSRMSLSSFSVNRPFLFFIF
EDTTGLPLFVGSVRNPNPSAPRELKEQQDSPGNKDFLQSLKGFPRGDKLFGPDLKLVPPM
EEDYPQFGSPK
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgctctgggggctcctggtgctcagctggtcctgcctgcaaggcccctgctcc
gtgttctcccctgtgagcgccatggagcccttgggccggcagctaactagcgggccgaac
caggagcaggtgtccccacttaccctcctcaagttgggcaaccaggagcctggtggccag
actgccctgaagagtcccccaggagtctgcagcagagaccccaccccagagcagacccac
aggctggcccgggccatgatggccttcactgccgacctgttctccctggtggctcaaacg
tccacctgccccaacctcatcctgtcacccctgagtgtggccctggcgctgtctcacctg
gcactaggtgctcagaaccacacgttgcagaggctgcaacaggtgctgcacgcaggctca
gggccctgcctcccccatctgctgagccgcctctgccaggacctgggccccggcgcgttc
cgactggctgccaggatgtacctgcagaaaggatttcccatcaaagaagatttcctggaa
caatccgaacagctatttggggcaaagcccgtgagcctgacgggaaagcaggaagatgac
ctggcaaacatcaaccaatgggtgaaggaggccacggaggggaagattcaggaattcctc
tctgggctgccggaagacaccgtgttgcttctcctcaacgccatccacttccagggtttc
tggaggaacaagtttgacccgagccttacccagagagactccttccacctggacgagcag
ttcacggtgcccgtggaaatgatgcaggcccgcacgtacccgctgcgctggttcttgctg
gagcagcctgagatccaggtggctcatttcccctttaagaacaacatgagctttgtggtc
cttgtacccacccactttgaatggaacgtgtcccaggtactggccaacctgagttgggac
accctgcacccacctctggtgtgggagaggcccaccaaggtccggctgcctaagctgtat
ctgaaacaccaaatggacctggtggccaccctcagccagctgggcctgcaggagttgttc
caggccccagacctgcgtgggatctccgagcagagcctggtggtgtccggcgtgcagcat
cagtccaccctggagctcagcgaggtcggcgtggaggcggcggcggccaccagcattgcc
atgtcccgcatgtccctgtcctccttcagcgtgaaccgccccttcctcttcttcatcttc
gaggacaccacaggccttcccctcttcgtgggcagcgtgaggaaccccaaccccagtgca
ccgcgggagctcaaggaacagcaggattccccgggcaacaaggacttcctccagagcctg
aaaggcttcccccgcggagacaagcttttcggccctgacttaaaacttgtgccccccatg
gaggaggattacccccagtttggcagccccaagtga

DBGET integrated database retrieval system