KEGG   Homo sapiens (human): 535Help
Entry
535               CDS       T01001                                 

Gene name
ATP6V0A1, ATP6N1, ATP6N1A, Stv1, VPP1, Vph1, a1
Definition
ATPase, H+ transporting, lysosomal V0 subunit a1 (EC:3.6.3.14)
Orthology
K02154  
V-type H+-transporting ATPase subunit a
Organism
hsa  Homo sapiens (human)
Pathway
Oxidative phosphorylation
Metabolic pathways
Lysosome
Phagosome
Synaptic vesicle cycle
Collecting duct acid secretion
Vibrio cholerae infection
Epithelial cell signaling in Helicobacter pylori infection
Tuberculosis
Rheumatoid arthritis
Module
V-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    535 (ATP6V0A1)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    535 (ATP6V0A1)
   04142 Lysosome
    535 (ATP6V0A1)
 Organismal Systems
  Excretory system
   04966 Collecting duct acid secretion
    535 (ATP6V0A1)
  Nervous system
   04721 Synaptic vesicle cycle
    535 (ATP6V0A1)
 Human Diseases
  Immune diseases
   05323 Rheumatoid arthritis
    535 (ATP6V0A1)
  Infectious diseases
   05110 Vibrio cholerae infection
    535 (ATP6V0A1)
   05120 Epithelial cell signaling in Helicobacter pylori infection
    535 (ATP6V0A1)
   05152 Tuberculosis
    535 (ATP6V0A1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   535 (ATP6V0A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17q21
AA seq 838 aa AA seqDB search
MGELFRSEEMTLAQLFLQSEAAYCCVSELGELGKVQFRDLNPDVNVFQRKFVNEVRRCEE
MDRKLRFVEKEIRKANIPIMDTGENPEVPFPRDMIDLEANFEKIENELKEINTNQEALKR
NFLELTELKFILRKTQQFFDEAELHHQQMADPDLLEESSSLLEPSEMGRGTPLRLGFVAG
VINRERIPTFERMLWRVCRGNVFLRQAEIENPLEDPVTGDYVHKSVFIIFFQGDQLKNRV
KKICEGFRASLYPCPETPQERKEMASGVNTRIDDLQMVLNQTEDHRQRVLQAAAKNIRVW
FIKVRKMKAIYHTLNLCNIDVTQKCLIAEVWCPVTDLDSIQFALRRGTEHSGSTVPSILN
RMQTNQTPPTYNKTNKFTYGFQNIVDAYGIGTYREINPAPYTIITFPFLFAVMFGDFGHG
ILMTLFAVWMVLRESRILSQKNENEMFSTVFSGRYIILLMGVFSMYTGLIYNDCFSKSLN
IFGSSWSVRPMFTYNWTEETLRGNPVLQLNPALPGVFGGPYPFGIDPIWNIATNKLTFLN
SFKMKMSVILGIIHMLFGVSLSLFNHIYFKKPLNIYFGFIPEIIFMTSLFGYLVILIFYK
WTAYDAHTSENAPSLLIHFINMFLFSYPESGYSMLYSGQKGIQCFLVVVALLCVPWMLLF
KPLVLRRQYLRRKHLGTLNFGGIRVGNGPTEEDAEIIQHDQLSTHSEDADEFDFGDTMVH
QAIHTIEYCLGCISNTASYLRLWALSLAHAQLSEVLWTMVIHIGLSVKSLAGGLVLFFFF
TAFATLTVAILLIMEGLSAFLHALRLHWVEFQNKFYSGTGFKFLPFSFEHIREGKFEE
NT seq 2517 nt NT seq  +upstreamnt  +downstreamnt
atgggggagcttttccggagtgaagaaatgacactggcccagctttttctacagtcagag
gctgcttattgttgtgtcagtgaattaggagaacttggaaaggttcagtttcgtgactta
aatccagatgtgaatgttttccaacggaaatttgtgaatgaagttagaagatgtgaagaa
atggatcgaaagcttcgatttgttgagaaagagataagaaaagctaacattccgattatg
gacaccggtgaaaacccagaggttcccttcccccgggacatgattgacttagaggccaat
tttgagaagattgaaaatgaactgaaggaaatcaacacaaaccaggaagctctgaagaga
aacttcctggaactgaccgaattaaaatttatacttcgcaaaactcagcaattttttgat
gaggctgaattgcatcatcagcagatggcggatccagacttgttggaagagtcctcatcc
ctcttggagccaagtgagatgggaagaggcactcctttaagacttggcttcgtggctggt
gtcattaaccgggagcgcatccctacttttgagcgcatgctttggcgggtatgccgggga
aatgtgttcctgcgacaggctgaaatcgagaaccccctggaggatcctgtgactggcgac
tacgtgcacaagtctgtgtttatcattttcttccaaggcgatcagctgaaaaacagagtc
aagaaaatctgtgaagggttccgagcctcactctatccctgtcctgagacaccacaggag
aggaaggaaatggcttctggagtgaataccaggattgatgatctccaaatggttctgaat
caaacggaggatcaccgccagagggttctgcaggcagctgctaagaacatccgtgtctgg
ttcatcaaagtgcggaagatgaaggccatctatcacaccctgaacctgtgcaacatagat
gtgactcagaaatgcttgattgcagaggtctggtgccctgtcaccgaccttgactccatc
cagtttgcactcagaaggggcacggaacacagtggttccactgtaccttccattttgaac
aggatgcagacaaaccagactcccccaacctataacaaaaccaacaagtttacctatggc
tttcagaacatagtagatgcttatggaattggaacttaccgagagataaatccagctccg
tatactattatcacgttcccttttctatttgctgtgatgtttggagacttcggtcatggc
attttaatgaccctttttgctgtgtggatggtactgagggagagccggatcctttcccag
aagaatgagaatgagatgtttagcactgtgttcagtggtcgatacattattttattgatg
ggtgtgttctccatgtacactggcctcatctacaatgattgcttttccaagtctcttaat
atctttgggtcatcctggagtgtacggccgatgtttacttataattggactgaagagacg
cttcgggggaaccctgttctacagctgaacccagccctccctggagtgtttggtggacca
tacccttttggcattgatccaatttggaacattgctaccaataaactgacgttcttgaac
tcctttaagatgaagatgtctgttatccttggtatcatccatatgctgtttggagtcagc
ctgagtctgttcaaccatatctatttcaagaagcccctgaatatctactttggatttatt
cctgaaataatcttcatgacctctttgtttggctatttggttatccttattttttacaag
tggacggcctatgatgctcatacctctgagaatgcaccaagccttctgatccatttcata
aacatgttcctcttttcctacccagagtctggttattcaatgttgtattctggacagaaa
ggaattcagtgtttcctggtagtggttgcactactgtgtgtaccttggatgctgctgttt
aaaccattggtccttcgccgtcagtatttgaggagaaagcatttgggaactctcaacttt
ggtgggatcagggtgggcaacggaccgacagaggaggatgctgagattattcagcatgac
cagctctccacccactcagaggacgcagacgagtttgactttggggacaccatggtccac
caggccatccacaccatcgagtactgcctgggctgcatctccaacactgcctcctacttg
cggctctgggccctcagcctcgctcatgcgcagctgtctgaggtgctttggaccatggtg
atccacatcggcctgagcgtgaagagcttggcgggaggtttggtgctgttcttcttcttc
actgcctttgccaccctgaccgtggccatcctcctgatcatggagggcctctcggccttt
ctccacgcactgcgcttacactgggttgagttccagaataaattctacagcgggaccggt
ttcaagttcttacccttctccttcgagcatattcgggaagggaagtttgaagagtga

DBGET integrated database retrieval system