KEGG   Homo sapiens (human): 5350Help
Entry
5350              CDS       T01001                                 

Gene name
PLN, CMD1P, CMH18, PLB
Definition
phospholamban
Orthology
K05852  
phospholamban
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
cGMP-PKG signaling pathway
Adrenergic signaling in cardiomyocytes
Thyroid hormone signaling pathway
Dilated cardiomyopathy
Disease
H00294  
Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    5350 (PLN)
   04022 cGMP - PKG signaling pathway
    5350 (PLN)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    5350 (PLN)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    5350 (PLN)
 Human Diseases
  Cardiovascular diseases
   05414 Dilated cardiomyopathy (DCM)
    5350 (PLN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
6q22.1
AA seq 52 aa AA seqDB search
MEKVQYLTRSAIRRASTIEMPQQARQKLQNLFINFCLILICLLLICIIVMLL
NT seq 159 nt NT seq  +upstreamnt  +downstreamnt
atggagaaagtccaatacctcactcgctcagctataagaagagcctcaaccattgaaatg
cctcaacaagcacgtcaaaagctacagaatctatttatcaatttctgtctcatcttaata
tgtctcttgctgatctgtatcatcgtgatgcttctctga

DBGET integrated database retrieval system