KEGG   Homo sapiens (human): 5351Help
Entry
5351              CDS       T01001                                 

Gene name
PLOD1, EDS6, LH, LH1, LLH, PLOD
Definition
procollagen-lysine, 2-oxoglutarate 5-dioxygenase 1 (EC:1.14.11.4)
Orthology
K00473  
procollagen-lysine,2-oxoglutarate 5-dioxygenase 1 [EC:1.14.11.4]
Organism
hsa  Homo sapiens (human)
Pathway
Lysine degradation
Disease
H00802  
Ehlers-Danlos syndrome (EDS)
H00980  
Nevo syndrome
Class
Metabolism; Amino acid metabolism; Lysine degradation [PATH:hsa00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1p36.22
AA seq 727 aa AA seqDB search
MRPLLLLALLGWLLLAEAKGDAKPEDNLLVLTVATKETEGFRRFKRSAQFFNYKIQALGL
GEDWNVEKGTSAGGGQKVRLLKKALEKHADKEDLVILFADSYDVLFASGPRELLKKFRQA
RSQVVFSAEELIYPDRRLETKYPVVSDGKRFLGSGGFIGYAPNLSKLVAEWEGQDSDSDQ
LFYTKIFLDPEKREQINITLDHRCRIFQNLDGALDEVVLKFEMGHVRARNLAYDTLPVLI
HGNGPTKLQLNYLGNYIPRFWTFETGCTVCDEGLRSLKGIGDEALPTVLVGVFIEQPTPF
VSLFFQRLLRLHYPQKHMRLFIHNHEQHHKAQVEEFLAQHGSEYQSVKLVGPEVRMANAD
ARNMGADLCRQDRSCTYYFSVDADVALTEPNSLRLLIQQNKNVIAPLMTRHGRLWSNFWG
ALSADGYYARSEDYVDIVQGRRVGVWNVPYISNIYLIKGSALRGELQSSDLFHHSKLDPD
MAFCANIRQQDVFMFLTNRHTLGHLLSLDSYRTTHLHNDLWEVFSNPEDWKEKYIHQNYT
KALAGKLVETPCPDVYWFPIFTEVACDELVEEMEHFGQWSLGNNKDNRIQGGYENVPTID
IHMNQIGFEREWHKFLLEYIAPMTEKLYPGYYTRAQFDLAFVVRYKPDEQPSLMPHHDAS
TFTINIALNRVGVDYEGGGCRFLRYNCSIRAPRKGWTLMHPGRLTHYHEGLPTTRGTRYI
AVSFVDP
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atgcggcccctgctgctactggccctgctgggctggctgctgctggccgaagcgaagggc
gacgccaagccggaggacaaccttttagtcctcacggtggccactaaggagaccgaggga
ttccgtcgcttcaagcgctcagctcagttcttcaactacaagatccaggcgcttggccta
ggggaggactggaatgtggagaaggggacgtcggcaggtggagggcagaaggtccggctg
ctgaagaaagctctggagaagcacgcagacaaggaggatctggtcattctcttcgcagac
agctatgacgtgctgtttgcatcggggccccgggagctcctgaagaagttccggcaggcc
aggagccaggtggtcttctctgctgaggagctcatctacccagaccgcaggctggagacc
aagtatccggtggtgtccgatggcaagaggttcctgggctctggaggcttcatcggttat
gcccccaacctcagcaaactggtggccgagtgggagggccaggacagcgacagcgatcag
ctgttttacaccaagatcttcttggacccggagaagagggagcagatcaatatcaccctg
gaccaccgctgccgtatcttccagaacctggatggagccttggatgaggtcgtgctcaag
tttgaaatgggccatgtgagagcgaggaacctggcctatgacaccctcccggtcctgatc
catggcaacgggccaaccaagctgcagttgaactacctgggcaactacatcccgcgcttc
tggaccttcgaaacaggctgcaccgtgtgtgacgaaggcttgcgcagcctcaagggcatt
ggggatgaagctctgcccacggtcctggtcggcgtgttcatcgaacagcccacgccgttt
gtgtccctgttcttccagcggctcctgcggctccactacccccagaaacacatgcgactt
ttcatccacaaccacgagcagcaccacaaggctcaggtggaagagttcctggcacagcat
ggcagcgagtaccagtctgtgaagctggtgggccctgaggtgcggatggcgaatgcagat
gccaggaacatgggcgcagacctgtgccggcaggaccgcagctgcacctactacttcagc
gtggatgctgacgtggccctgaccgagcccaacagcctgcggctgctgatccaacagaac
aagaacgtcattgccccgctgatgacccggcatgggaggctgtggtcgaacttctggggg
gctctcagtgcagatggctactatgcccgttccgaggactacgtggacattgtgcagggg
cggcgtgttggtgtctggaatgtgccctatatttcaaacatctacttgatcaagggcagt
gccctgcggggtgagctgcagtcctcagatctcttccaccacagcaagctggaccccgac
atggccttctgtgccaacatccggcagcaggatgtgttcatgttcctgaccaaccggcac
acccttggccatctgctctccctagacagctaccgcaccacccacctgcacaacgacctc
tgggaggtgttcagcaaccccgaggactggaaggagaagtacatccaccagaactacacc
aaagccctggcagggaagctggtggagacgccctgcccggatgtctattggttccccatc
ttcacggaggtggcctgtgatgagctggtggaggagatggagcactttggccagtggtct
ctgggcaacaacaaggacaaccgcatccagggtggctacgagaacgtgccgactattgac
atccacatgaaccagatcggctttgagcgggagtggcacaaattcctgctggagtacatt
gcgcccatgacggagaagctctaccccggctactacaccagggcccagtttgacctggcc
tttgtcgtccgctacaagcctgatgagcagccctcactgatgccacaccatgatgcctcc
accttcaccatcaacatcgccctgaaccgagtcggggtggattacgagggcgggggctgt
cggttcctgcgctacaactgttccatccgagccccaaggaagggctggaccctcatgcac
cctggacgactcacgcattaccatgaggggctccccaccaccaggggcacccgctacatc
gcagtctccttcgtcgatccctaa

DBGET integrated database retrieval system