KEGG   Homo sapiens (human): 5360Help
Entry
5360              CDS       T01001                                 

Gene name
PLTP, BPIFE, HDLCQ9
Definition
(RefSeq) phospholipid transfer protein
  KO
K08761  
phospholipid transfer protein
Organism
hsa  Homo sapiens (human)
Pathway
PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    5360 (PLTP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
20q13.12
AA seq 493 aa AA seqDB search
MALFGALFLALLAGAHAEFPGCKIRVTSKALELVKQEGLRFLEQELETITIPDLRGKEGH
FYYNISEVKVTELQLTSSELDFQPQQELMLQITNASLGLRFRRQLLYWFFYDGGYINASA
EGVSIRTGLELSRDPAGRMKVSNVSCQASVSRMHAAFGGTFKKVYDFLSTFITSGMRFLL
NQQICPVLYHAGTVLLNSLLDTVPVRSSVDELVGIDYSLMKDPVASTSNLDMDFRGAFFP
LTERNWSLPNRAVEPQLQEEERMVYVAFSEFFFDSAMESYFRAGALQLLLVGDKVPHDLD
MLLRATYFGSIVLLSPAVIDSPLKLELRVLAPPRCTIKPSGTTISVTASVTIALVPPDQP
EVQLSSMTMDARLSAKMALRGKALRTQLDLRRFRIYSNHSALESLALIPLQAPLKTMLQI
GVMPMLNERTWRGVQIPLPEGINFVHEVVTNHAGFLTIGADLHFAKGLREVIEKNRPADV
RASTAPTPSTAAV
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atggccctcttcggggccctcttcctagcgctgctggcaggcgcacatgcagagttccca
ggctgcaagatccgcgtcacctccaaggcgctggagctggtgaagcaggaggggctgcgc
tttctggagcaagagctggagactatcaccattccggacctgcggggcaaagaaggccac
ttctactacaacatctctgaggtgaaggtcacagagctgcaactgacatcttccgagctc
gatttccagccacagcaggagctgatgcttcaaatcaccaatgcctccttggggctgcgc
ttccggagacagctgctctactggttcttctatgatgggggctacatcaacgcctcagct
gagggtgtgtccatccgcactggtctggagctctcccgggatcccgctggacggatgaaa
gtgtccaatgtctcctgccaggcctctgtctccagaatgcacgcggccttcgggggaacc
ttcaagaaggtgtatgattttctctccacgttcatcacctcagggatgcgcttcctcctc
aaccagcagatctgccctgtcctctaccacgcagggacggtcctgctcaactccctcctg
gacaccgtgcctgtgcgcagttctgtggacgagcttgttggcattgactattccctcatg
aaggatcctgtggcttccaccagcaacctggacatggacttccggggggccttcttcccc
ctgactgagaggaactggagcctccccaaccgggcagtggagccccagctgcaggaggaa
gagcggatggtgtatgtggccttctctgagttcttcttcgactctgccatggagagctac
ttccgggcgggggccctgcagctgttgctggtgggggacaaggtgccccacgacctggac
atgctgctgagggccacctactttgggagcattgtcctgctgagcccagcagtgattgac
tccccattgaagctggagctgcgggtcctggccccaccgcgctgcaccatcaagccctct
ggcaccaccatctctgtcactgctagcgtcaccattgccctggtcccaccagaccagcct
gaggtccagctgtccagcatgactatggacgcccgtctcagcgccaagatggctctccgg
gggaaggccctgcgcacgcagctggacctgcgcaggttccgaatctattccaaccattct
gcactggagtcgctggctctgatcccattacaggcccctctgaagaccatgctgcagatt
ggggtgatgcccatgctcaatgagcggacctggcgtggggtgcagatcccactacctgag
ggcatcaactttgtgcatgaggtggtgacgaaccatgcgggattcctcaccatcggggct
gatctccactttgccaaagggctgcgagaggtgattgagaagaaccggcctgctgatgtc
agggcgtccactgcccccacaccgtccacagcagctgtctga

DBGET integrated database retrieval system