KEGG   Homo sapiens (human): 5361Help
Entry
5361              CDS       T01001                                 

Gene name
PLXNA1, NOV, NOVP, PLEXIN-A1, PLXN1
Definition
(RefSeq) plexin A1
  KO
K06820  
plexin A
Organism
hsa  Homo sapiens (human)
Pathway
Axon guidance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Development
   04360 Axon guidance
    5361 (PLXNA1)
Cell adhesion molecules and their ligands [BR:hsa04516]
 1. Immunoglobulin Superfamily
  Neural system
   6/5 subfamily
    NRCAM; neuronal cell adhesion molecule [KO:K06756]
     5361 (PLXNA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3q21.3
AA seq 1896 aa AA seqDB search
MPLPPRSLQVLLLLLLLLLLLPGMWAEAGLPRAGGGSQPPFRTFSASDWGLTHLVVHEQT
GEVYVGAVNRIYKLSGNLTLLRAHVTGPVEDNEKCYPPPSVQSCPHGLGSTDNVNKLLLL
DYAANRLLACGSASQGICQFLRLDDLFKLGEPHHRKEHYLSSVQEAGSMAGVLIAGPPGQ
GQAKLFVGTPIDGKSEYFPTLSSRRLMANEEDADMFGFVYQDEFVSSQLKIPSDTLSKFP
AFDIYYVYSFRSEQFVYYLTLQLDTQLTSPDAAGEHFFTSKIVRLCVDDPKFYSYVEFPI
GCEQAGVEYRLVQDAYLSRPGRALAHQLGLAEDEDVLFTVFAQGQKNRVKPPKESALCLF
TLRAIKEKIKERIQSCYRGEGKLSLPWLLNKELGCINSPLQIDDDFCGQDFNQPLGGTVT
IEGTPLFVDKDDGLTAVAAYDYRGRTVVFAGTRSGRIRKILVDLSNPGGRPALAYESVVA
QEGSPILRDLVLSPNHQYLYAMTEKQVTRVPVESCVQYTSCELCLGSRDPHCGWCVLHSI
CSRRDACERADEPQRFAADLLQCVQLTVQPRNVSVTMSQVPLVLQAWNVPDLSAGVNCSF
EDFTESESVLEDGRIHCRSPSAREVAPITRGQGDQRVVKLYLKSKETGKKFASVDFVFYN
CSVHQSCLSCVNGSFPCHWCKYRHVCTHNVADCAFLEGRVNVSEDCPQILPSTQIYVPVG
VVKPITLAARNLPQPQSGQRGYECLFHIPGSPARVTALRFNSSSLQCQNSSYSYEGNDVS
DLPVNLSVVWNGNFVIDNPQNIQAHLYKCPALRESCGLCLKADPRFECGWCVAERRCSLR
HHCAADTPASWMHARHGSSRCTDPKILKLSPETGPRQGGTRLTITGENLGLRFEDVRLGV
RVGKVLCSPVESEYISAEQIVCEIGDASSVRAHDALVEVCVRDCSPHYRALSPKRFTFVT
PTFYRVSPSRGPLSGGTWIGIEGSHLNAGSDVAVSVGGRPCSFSWRNSREIRCLTPPGQS
PGSAPIIININRAQLTNPEVKYNYTEDPTILRIDPEWSINSGGTLLTVTGTNLATVREPR
IRAKYGGIERENGCLVYNDTTMVCRAPSVANPVRSPPELGERPDELGFVMDNVRSLLVLN
STSFLYYPDPVLEPLSPTGLLELKPSSPLILKGRNLLPPAPGNSRLNYTVLIGSTPCTLT
VSETQLLCEAPNLTGQHKVTVRAGGFEFSPGTLQVYSDSLLTLPAIVGIGGGGGLLLLVI
VAVLIAYKRKSRDADRTLKRLQLQMDNLESRVALECKEAFAELQTDIHELTNDLDGAGIP
FLDYRTYAMRVLFPGIEDHPVLKEMEVQANVEKSLTLFGQLLTKKHFLLTFIRTLEAQRS
FSMRDRGNVASLIMTALQGEMEYATGVLKQLLSDLIEKNLESKNHPKLLLRRTESVAEKM
LTNWFTFLLYKFLKECAGEPLFMLYCAIKQQMEKGPIDAITGEARYSLSEDKLIRQQIDY
KTLTLNCVNPENENAPEVPVKGLDCDTVTQAKEKLLDAAYKGVPYSQRPKAADMDLEWRQ
GRMARIILQDEDVTTKIDNDWKRLNTLAHYQVTDGSSVALVPKQTSAYNISNSSTFTKSL
SRYESMLRTASSPDSLRSRTPMITPDLESGTKLWHLVKNHDHLDQREGDRGSKMVSEIYL
TRLLATKGTLQKFVDDLFETIFSTAHRGSALPLAIKYMFDFLDEQADKHQIHDADVRHTW
KSNCLPLRFWVNVIKNPQFVFDIHKNSITDACLSVVAQTFMDSCSTSEHKLGKDSPSNKL
LYAKDIPNYKSWVERYYADIAKMPAISDQDMSAYLAEQSRLHLSQFNSMSALHEIYSYIT
KYKDEILAALEKDEQARRQRLRSKLEQVVDTMALSS
NT seq 5691 nt NT seq  +upstreamnt  +downstreamnt
atgccgctgccaccgcggagcctgcaggtgctcctgctgctgctgctgttgctgctgctg
ctgccgggcatgtgggctgaggcaggcttgcccagggcaggcgggggttcacagcccccc
ttccgcaccttctcggccagcgactggggcctcacccacctagtggtgcatgagcagaca
ggcgaggtgtatgtgggcgcagtgaaccgcatctataagctgtcggggaacctgacactg
ctgcgggcccacgtcacgggccctgtggaggacaacgagaagtgctacccgccgcccagc
gtgcagtcctgcccccacggcctgggcagtactgacaacgtcaacaagctgctgctgctg
gactatgccgctaaccgcctgctggcctgtggcagcgcctcccagggcatctgccagttc
ctgcgtctggacgatctcttcaaactgggtgagccacaccaccgtaaggagcactacctg
tccagcgtgcaggaggcaggcagcatggcgggcgtgctcattgccgggccaccgggccag
ggccaggccaagctcttcgtgggcacacccatcgatggcaagtccgagtacttccccaca
ctgtccagccgtcggctcatggccaacgaggaggatgccgacatgttcggcttcgtgtac
caggatgagtttgtgtcatcacagctcaagatcccttcggacacgctgtccaagttcccg
gcctttgacatctactatgtgtacagcttccgcagcgagcagtttgtctactacctcacg
ctgcagctagacacacagctgacctcgcctgatgccgccggcgagcacttcttcacgtcc
aagatcgtgcggctctgtgtggacgaccccaaattctactcgtacgttgagttccccatt
ggctgcgagcaggcgggtgtggagtaccgcctggtgcaggatgcctacctgagccggccc
ggccgtgccctggcccaccagctgggcctggctgaggacgaggacgtgctgttcactgtg
ttcgcccagggccagaagaaccgcgtgaagccaccaaaggagtcagcactgtgcctgttc
acgctcagggccatcaaggagaagattaaggagcgcatccagtcctgctaccgtggtgag
ggcaagctctccctgccgtggctgctcaacaaggagctgggctgcatcaactcgcccctg
cagatcgatgacgacttctgcgggcaggacttcaaccagcccctggggggcacagtcacc
attgaggggacgcccctgttcgtggacaaggatgatggcctgaccgccgtggctgcctat
gactatcggggccgcactgtggtattcgccggcacgcgaagtggccgcatccgcaagatc
ctggtggacctctcaaaccccggtggccggcctgccctggcctacgagagcgtcgtggcc
caggagggcagccccatcctgcgagacctcgtcctcagccccaaccaccagtacctctac
gccatgaccgagaagcaggtgacgcgggtgcctgtggagagctgtgtgcagtacacgtcc
tgtgagctgtgtctggggtcacgggacccccactgtggctggtgtgtcctgcacagcatc
tgctcgcggcgggacgcctgtgagcgagcagacgagccccagcgctttgctgcggacctg
ctgcagtgtgtgcagctgactgtgcagccccgcaatgtgtctgtcaccatgtcccaggtc
ccacttgtgctgcaggcctggaacgtgcctgacctctcagctggcgtcaactgctccttc
gaggacttcacggaatctgagagcgtcctggaggatggccggatccactgccgctcaccc
tccgcccgggaggtggcgcccatcacgcggggccagggagaccagcgggtggtgaaactc
tacctaaagtccaaggagacagggaagaagtttgcgtctgtggacttcgtcttctacaac
tgcagcgtccaccagtcctgcctgtcctgtgtcaacggctcctttccctgccactggtgc
aaataccgccacgtgtgcacacacaacgtggctgactgcgccttcctggagggccgtgtc
aacgtgtctgaggactgcccacagatcctgccctccacgcagatctacgtgccagtggga
gtggtaaaacccatcaccctggccgcacggaacctgccacagccacagtcaggccagcgt
ggatatgagtgcctcttccacatcccgggcagcccggcccgtgtcaccgccctgcgcttc
aacagctccagcctgcagtgccagaattcctcgtactcctacgaggggaacgatgtcagc
gacctgccagtgaacctgtcagtcgtgtggaacggcaactttgtcattgacaacccacag
aacatccaggcgcacctctacaagtgcccggccctgcgcgagagctgcggcctctgcctc
aaggccgacccgcgcttcgagtgcggatggtgcgtggccgagcgccgctgctccctgcga
caccactgcgctgccgacacacctgcatcgtggatgcacgcgcgtcacggcagcagtcgc
tgcaccgaccccaagatcctcaagctgtcccccgagacgggcccgaggcagggcggcacg
cggctcactatcacaggcgagaacctgggcctgcgattcgaagacgtgcgtctgggcgtg
cgcgtgggcaaggtgctgtgcagccctgtggagagcgagtacatcagtgcggagcagatc
gtctgtgagatcggggacgccagctccgtgcgtgcccatgacgccctggtggaggtgtgt
gtgcgggactgctcaccacactaccgcgccctgtcacccaagcgcttcaccttcgtgaca
ccaaccttctaccgtgtgagcccctcccgtgggcctctgtcagggggcacctggattggc
atcgagggaagccacctgaacgcaggcagtgatgtggctgtgtcggtcggtggccggccc
tgctccttctcctggaggaactcccgtgagatccggtgcctgacaccccccgggcagagc
cctggcagcgctcccatcatcatcaacatcaaccgcgcccagctcaccaaccctgaggtg
aagtacaactacaccgaggaccccaccatcctgaggatcgaccccgagtggagcatcaac
agcggtgggaccctcctgacggtcacaggcaccaacctggccactgtccgtgaaccccga
atccgggccaagtatggaggcattgagagggagaacggctgcctggtgtacaatgacacc
accatggtatgccgcgccccgtctgtggccaaccctgtgcgcagcccaccagagctgggg
gagcggccggatgagctgggcttcgtcatggacaacgtgcgctccctgcttgtgctcaac
tccacctccttcctctactaccctgaccccgtactggagccactcagccccactggcctg
ctggagctgaagcccagctccccactcatcctcaagggccggaacctcttgccacctgca
cccggcaactcccgactcaactacacggtgctcatcggctccacaccctgtaccctcacc
gtgtcggagacgcaactgctgtgcgaggcgcccaacctcactgggcagcacaaggtcacg
gtgcgggcaggtggcttcgagttctcgccagggacactgcaggtgtactcggacagcctg
ctgacgctgcctgccattgtgggcattggcggaggcgggggtctcctgctgctggtcatc
gtggctgtgctcatcgcctacaagcgcaagtcacgagatgctgaccgcacactcaagcgg
ctgcagctccagatggacaacctggagtcccgcgtggccctcgaatgcaaggaagccttt
gcagagctgcagacagacatccacgagctgaccaatgacctggacggtgccggcatcccc
ttccttgactaccggacatatgccatgcgggtgctctttcctgggatcgaggaccaccct
gtgctcaaggagatggaggtgcaggccaatgtggagaagtcgctgacactgttcgggcag
ctgctgaccaagaagcacttcctgctgaccttcatccgcacgctggaggcacagcgcagc
ttctccatgcgcgaccgcgggaatgtggcctcgctcatcatgacggccctgcagggcgag
atggaatacgccacaggcgtgctcaagcagctgctttccgacctcatcgagaagaacctg
gagagcaagaaccaccccaagctgctactgcgccggactgagtcggtggcagagaagatg
ctaactaactggttcaccttcctcttgtataagttcctcaaggagtgcgctggggagccg
ctgttcatgctgtactgcgccatcaagcagcagatggagaagggccccattgacgccatc
acgggtgaggcacgctactccctgagtgaggacaagctcatccggcagcagattgactac
aagacactgaccctgaactgtgtgaaccctgagaatgagaatgcacctgaggtgccggtg
aaggggctggactgtgacacggtcacccaggccaaggagaagctgctggacgctgcctac
aagggcgtgccctactcccagcggcccaaggccgcggacatggacctggagtggcgccag
ggccgcatggcgcgcatcatcctgcaggacgaggacgtcaccaccaagattgacaacgat
tggaagaggctgaacacactggctcactaccaggtgacagacgggtcctcggtggcactg
gtgcccaagcagacgtccgcctacaacatctccaactcctccaccttcaccaagtccctc
agcagatacgagagcatgctgcgcacggccagcagccccgacagcctgcgctcgcgcacg
cccatgatcacgcccgacctggagagcggcaccaagctgtggcacctggtgaagaaccac
gaccacctggaccagcgtgagggtgaccgcggcagcaagatggtctcggagatctacttg
acacggctactggccaccaagggcacactgcagaagtttgtggacgacctgtttgagacc
atcttcagcacggcacaccggggctcagccctgccgctggccatcaagtacatgttcgac
ttcctggatgagcaggccgacaagcaccagatccacgatgctgacgtgcgccacacctgg
aagagcaactgcctgcccctgcgcttctgggtgaacgtgatcaagaacccacagtttgtg
ttcgacattcacaagaacagcatcacggacgcctgcttgtcggtggtggcccagaccttc
atggactcctgctccacctctgagcacaagctgggcaaggactcaccctccaacaagctg
ctctacgccaaggacatccccaactacaagagctgggtggagaggtactatgcagacatc
gccaagatgccagccatcagcgaccaggacatgagtgcgtatctggctgagcagtcccgc
ctgcacctgagccagttcaacagcatgagcgccttgcacgagatctactcctacatcacc
aagtacaaggatgagatcctggcagccctggagaaggatgagcaggcgcggcggcagcgg
ctgcggagcaagctggagcaggtggtggacacgatggccctgagcagctga

DBGET integrated database retrieval system