KEGG   Homo sapiens (human): 53616Help
Entry
53616             CDS       T01001                                 

Gene name
ADAM22, ADAM_22, MDC2
Definition
ADAM metallopeptidase domain 22
Orthology
K16068  
disintegrin and metalloproteinase domain-containing protein 22 [EC:3.4.24.-]
Organism
hsa  Homo sapiens (human)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
7q21
AA seq 859 aa AA seqDB search
MQAAVAVSVPFLLLCVLGTCPPARCGQAGDASLMELEKRKENRFVERQSIVPLRLIYRSG
GEDESRHDALDTRVRGDLGGPQLTHVDQASFQVDAFGTSFILDVVLNHDLLSSEYIERHI
EHGGKTVEVKGGEHCYYQGHIRGNPDSFVALSTCHGLHGMFYDGNHTYLIEPEENDTTQE
DFHFHSVYKSRLFEFSLDDLPSEFQQVNITPSKFILKPRPKRSKRQLRRYPRNVEEETKY
IELMIVNDHLMFKKHRLSVVHTNTYAKSVVNMADLIYKDQLKTRIVLVAMETWATDNKFA
ISENPLITLREFMKYRRDFIKEKSDAVHLFSGSQFESSRSGAAYIGGICSLLKGGGVNEF
GKTDLMAVTLAQSLAHNIGIISDKRKLASGECKCEDTWSGCIMGDTGYYLPKKFTQCNIE
EYHDFLNSGGGACLFNKPSKLLDPPECGNGFIETGEECDCGTPAECVLEGAECCKKCTLT
QDSQCSDGLCCKKCKFQPMGTVCREAVNDCDIRETCSGNSSQCAPNIHKMDGYSCDGVQG
ICFGGRCKTRDRQCKYIWGQKVTASDKYCYEKLNIEGTEKGNCGKDKDTWIQCNKRDVLC
GYLLCTNIGNIPRLGELDGEITSTLVVQQGRTLNCSGGHVKLEEDVDLGYVEDGTPCGPQ
MMCLEHRCLPVASFNFSTCLSSKEGTICSGNGVCSNELKCVCNRHWIGSDCNTYFPHNDD
AKTGITLSGNGVAGTNIIIGIIAGTILVLALILGITAWGYKNYREQRQLPQGDYVKKPGD
GDSFYSDIPPGVSTNSASSSKKRSNGLSHSWSERIPDTKHISDICENGRPRSNSWQGNLG
GNKKKIRGKRFRPRSNSTE
NT seq 2580 nt NT seq  +upstreamnt  +downstreamnt
atgcaggcggcagtggctgtgtccgtgcccttcttgctgctctgtgtcctggggacctgc
cctccggcgcgctgcggccaggcaggagacgcctcattgatggagctagagaagaggaag
gaaaaccgcttcgtggagcgccagagcatcgtgccactgcgcctcatctaccgctcgggc
ggcgaagacgaaagtcggcacgacgcgctcgacacgcgggtgcggggcgacctcggtggc
ccgcagttgactcatgttgaccaagcaagcttccaggttgatgcctttggaacgtcattc
attctcgatgtcgtgctaaatcatgatttgctgtcctctgaatacatagagagacacatt
gaacatggaggcaagactgtggaagttaaaggaggagagcactgttactaccagggccat
atccgaggaaaccctgactcatttgttgcattgtcaacatgccacggacttcatgggatg
ttctatgacgggaaccacacatatctcattgagccagaagaaaatgacactactcaagag
gatttccattttcattcagtttacaaatccagactgtttgaattttccttggatgatctt
ccatctgaatttcagcaagtaaacattactccatcaaaatttattttgaagccaagacca
aaaaggagtaaacggcagcttcgtcgatatcctcgtaatgtagaagaagaaaccaaatac
attgaactgatgattgtgaatgatcaccttatgtttaaaaaacatcggctttccgttgta
cataccaatacctatgcgaaatctgtggtgaacatggcagatttaatatataaagaccaa
cttaagaccaggatagtattggttgctatggaaacctgggcgactgacaacaagtttgcc
atatctgaaaatccattgatcaccctacgtgagtttatgaaatacaggagggattttatc
aaagagaaaagtgatgcagttcaccttttttcgggaagtcaatttgagagtagccggagc
ggggcagcttatattggtgggatttgctcgttgctgaaaggaggaggcgtgaatgaattt
gggaaaactgatttaatggctgttacacttgcccagtcattagcccataatattggtatt
atctcagacaaaagaaagttagcaagtggtgaatgtaaatgcgaggacacgtggtccggg
tgcataatgggagacactggctattatcttcctaaaaagttcacccagtgtaatattgaa
gagtatcatgacttcctgaatagtggaggtggtgcctgccttttcaacaaaccttctaag
cttcttgatcctcctgagtgtggcaatggcttcattgaaactggagaggagtgtgattgt
ggaaccccggccgaatgtgtccttgaaggagcagagtgttgtaagaaatgcaccttgact
caagactctcaatgcagtgacggtctttgctgtaaaaagtgcaagtttcagcctatgggc
actgtgtgccgagaagcagtaaatgattgtgatattcgtgaaacgtgctcaggaaattca
agccagtgtgcccctaatattcataaaatggatggatattcatgtgatggtgttcaggga
atttgctttggaggaagatgcaaaaccagagatagacaatgcaaatacatttgggggcaa
aaggtgacagcatcagacaaatattgctatgagaaactgaatattgaagggacggagaag
ggtaactgtgggaaagacaaagacacatggatacagtgcaacaaacgggatgtgctttgt
ggttaccttttgtgtaccaatattggcaatatcccaaggcttggagaactcgatggtgaa
atcacatctactttagttgtgcagcaaggaagaacattaaactgcagtggtgggcatgtt
aagcttgaagaagatgtagatcttggctatgtggaagatgggacaccttgtggtccccaa
atgatgtgcttagaacacaggtgtcttcctgtggcttctttcaactttagtacttgcttg
agcagtaaagaaggcactatttgctcaggaaatggagtttgcagtaatgagctgaagtgt
gtgtgtaacagacactggataggttctgattgcaacacttacttccctcacaatgatgat
gcaaagactggtatcactctgtctggcaatggtgttgctggcaccaatatcataataggc
ataattgctggcaccattttagtgctggccctcatattaggaataactgcgtggggttat
aaaaactatcgagaacagagacagttaccccagggagattatgtaaaaaagcctggagat
ggtgactctttttatagcgacattcctcccggagtcagcacaaactcagcatctagttct
aagaagaggtcaaatgggctctctcattcttggagtgaaaggattccagacacaaaacat
atttcagacatctgtgaaaatgggcgacctcgaagtaactcttggcaaggtaacctggga
ggcaacaaaaagaaaatcagaggcaaaagatttagacctcggtctaattcaactgagtaa

DBGET integrated database retrieval system