KEGG   Homo sapiens (human): 53630Help
Entry
53630             CDS       T01001                                 

Gene name
BCMO1, BCDO, BCDO1, BCMO, BCO, BCO1
Definition
beta-carotene 15,15'-monooxygenase 1 (EC:1.14.99.36)
Orthology
K00515  
beta-carotene 15,15'-monooxygenase [EC:1.14.99.36]
Organism
hsa  Homo sapiens (human)
Pathway
Retinol metabolism
Metabolic pathways
Disease
H01266  
Hypercarotenemia and vitamin A deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    53630 (BCMO1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.36  beta-carotene 15,15'-monooxygenase
     53630 (BCMO1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
16q23.2
AA seq 547 aa AA seqDB search
MDIIFGRNRKEQLEPVRAKVTGKIPAWLQGTLLRNGPGMHTVGESRYNHWFDGLALLHSF
TIRDGEVYYRSKYLRSDTYNTNIEANRIVVSEFGTMAYPDPCKNIFSKAFSYLSHTIPDF
TDNCLINIMKCGEDFYATSETNYIRKINPQTLETLEKVDYRKYVAVNLATSHPHYDEAGN
VLNMGTSIVEKGKTKYVIFKIPATVPEGKKQGKSPWKHTEVFCSIPSRSLLSPSYYHSFG
VTENYVIFLEQPFRLDILKMATAYIRRMSWASCLAFHREEKTYIHIIDQRTRQPVQTKFY
TDAMVVFHHVNAYEEDGCIVFDVIAYEDNSLYQLFYLANLNQDFKENSRLTSVPTLRRFA
VPLHVDKNAEVGTNLIKVASTTATALKEEDGQVYCQPEFLYEGLELPRVNYAHNGKQYRY
VFATGVQWSPIPTKIIKYDILTKSSLKWREDDCWPAEPLFVPAPGAKDEDDGVILSAIVS
TDPQKLPFLLILDAKSFTELARASVDVDMHMDLHGLFITDMDWDTKKQAASEEQRDRASD
CHGAPLT
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atggatataatatttggcaggaataggaaagaacagctggagcctgtgagggccaaagtg
acaggcaagattccagcatggctgcagggaaccctgctccgcaatgggcctgggatgcac
acagttggggagtccagatacaaccattggttcgacggccttgccctgctccacagcttc
accatcagagacggtgaagtctattacaggagcaaatacctgagaagcgatacctacaac
accaatattgaggcaaacaggattgtggtgtctgagtttggaacaatggcctatccggac
ccctgcaaaaacatattttccaaagctttctcctacttgtctcacaccatccccgatttc
accgacaactgcctgatcaacatcatgaagtgcggagaagacttctacgcgacctcagag
accaattacatcaggaaaatcaacccacagactctggaaaccctggagaaggttgattat
cgtaaatacgtggcggtaaatctggcaacgtcacatccccattatgatgaggctggaaat
gttctaaacatgggcacatccattgtggaaaaggggaagacaaagtatgtgatttttaag
atccctgccacagtaccagagggcaagaagcaggggaagagcccctggaagcacacagag
gtgttctgctccatcccatcccgctccctgctctccccaagctactaccacagctttgga
gtcaccgagaactatgtcatcttccttgagcagcctttcaggttggatattctcaagatg
gcaaccgcatacatccggagaatgagctgggcctcctgcctggctttccacagggaggag
aagacttatatccacatcatcgaccaaaggaccaggcagcctgtgcagaccaagttttac
acagacgccatggtggtcttccatcacgtcaacgcctacgaagaggacggctgcatcgtg
tttgacgtcattgcctacgaggacaacagcctctaccagctcttctacctggccaacctg
aaccaggacttcaaggagaactccaggctcacctcggtccccaccctcaggaggtttgcc
gtgcccctccacgtggacaagaatgcagaagtgggcacaaatttaatcaaagtggcatct
acaacagccacggccctgaaggaagaagatggccaagtctactgccagccggaatttctt
tatgaaggcttagagcttccacgggtcaattatgctcacaatggaaagcaataccgatat
gtctttgctacaggagttcagtggagtccaatcccaaccaagataataaaatatgacatt
ctcacaaagtcatccttaaaatggagagaggacgactgctggccagcggaacccctgttt
gtgcccgcgccaggtgccaaggatgaggatgacggagtaatcttatcagccattgtctct
actgatccccaaaagctgccttttctgctcattctggatgccaaaagctttacggaattg
gcccgtgcctctgttgatgtcgatatgcacatggatctccatggattattcattacagac
atggactgggacacaaaaaagcaggccgcttctgaggaacagcgggacagggcttccgac
tgccacggggctcctctgacctga

DBGET integrated database retrieval system