KEGG   Homo sapiens (human): 53637Help
Entry
53637             CDS       T01001                                 

Gene name
S1PR5, EDG8, Edg-8, S1P5, SPPR-1, SPPR-2
Definition
(RefSeq) sphingosine-1-phosphate receptor 5
  KO
K04295  
sphingosine 1-phosphate receptor 5
Organism
hsa  Homo sapiens (human)
Pathway
Sphingolipid signaling pathway
Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04071 Sphingolipid signaling pathway
    53637 (S1PR5)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    53637 (S1PR5)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Lipid
   Sphingolipid [OT]
    53637 (S1PR5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q9H228(Tclin)
UniProt: 
Position
19p13.2
AA seq 398 aa AA seqDB search
MESGLLRPAPVSEVIVLHYNYTGKLRGARYQPGAGLRADAVVCLAVCAFIVLENLAVLLV
LGRHPRFHAPMFLLLGSLTLSDLLAGAAYAANILLSGPLTLKLSPALWFAREGGVFVALT
ASVLSLLAIALERSLTMARRGPAPVSSRGRTLAMAAAAWGVSLLLGLLPALGWNCLGRLD
ACSTVLPLYAKAYVLFCVLAFVGILAAICALYARIYCQVRANARRLPARPGTAGTTSTRA
RRKPRSLALLRTLSVVLLAFVACWGPLFLLLLLDVACPARTCPVLLQADPFLGLAMANSL
LNPIIYTLTNRDLRHALLRLVCCGRHSCGRDPSGSQQSASAAEASGGLRRCLPPGLDGSF
SGSERSSPQRDGLDTSGSTGSPGAPTAARTLVSEPAAD
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggagtcggggctgctgcggccggcgccggtgagcgaggtcatcgtcctgcattacaac
tacaccggcaagctccgcggtgcgcgctaccagccgggtgccggcctgcgcgccgacgcc
gtggtgtgcctggcggtgtgcgccttcatcgtgctagagaatctagccgtgttgttggtg
ctcggacgccacccgcgcttccacgctcccatgttcctgctcctgggcagcctcacgttg
tcggatctgctggcaggcgccgcctacgccgccaacatcctactgtcggggccgctcacg
ctgaaactgtcccccgcgctctggttcgcacgggagggaggcgtcttcgtggcactcact
gcgtccgtgctgagcctcctggccatcgcgctggagcgcagcctcaccatggcgcgcagg
gggcccgcgcccgtctccagtcgggggcgcacgctggcgatggcagccgcggcctggggc
gtgtcgctgctcctcgggctcctgccagcgctgggctggaattgcctgggtcgcctggac
gcttgctccactgtcttgccgctctacgccaaggcctacgtgctcttctgcgtgctcgcc
ttcgtgggcatcctggccgctatctgtgcactctacgcgcgcatctactgccaggtacgc
gccaacgcgcggcgcctgccggcacggcccgggactgcggggaccacctcgacccgggcg
cgtcgcaagccgcgctcgctggccttgctgcgcacgctcagcgtggtgctcctggccttt
gtggcatgttggggccccctcttcctgctgctgttgctcgacgtggcgtgcccggcgcgc
acctgtcctgtactcctgcaggccgatcccttcctgggactggccatggccaactcactt
ctgaaccccatcatctacacgctcaccaaccgcgacctgcgccacgcgctcctgcgcctg
gtctgctgcggacgccactcctgcggcagagacccgagtggctcccagcagtcggcgagc
gcggctgaggcttccgggggcctgcgccgctgcctgcccccgggccttgatgggagcttc
agcggctcggagcgctcatcgccccagcgcgacgggctggacaccagcggctccacaggc
agccccggtgcacccacagccgcccggactctggtatcagaaccggctgcagactga

DBGET integrated database retrieval system