KEGG   Homo sapiens (human): 5366Help
Entry
5366              CDS       T01001                                 

Gene name
PMAIP1, APR, NOXA
Definition
(RefSeq) phorbol-12-myristate-13-acetate-induced protein 1
  KO
K10131  
phorbol-12-myristate-13-acetate-induced protein 1
Organism
hsa  Homo sapiens (human)
Pathway
Platinum drug resistance
p53 signaling pathway
Apoptosis
Apoptosis - multiple species
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    5366 (PMAIP1)
   04215 Apoptosis - multiple species
    5366 (PMAIP1)
   04115 p53 signaling pathway
    5366 (PMAIP1)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    5366 (PMAIP1)
  Antineoplastic resistance
   01524 Platinum drug resistance
    5366 (PMAIP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
18q21.32
AA seq 54 aa AA seqDB search
MPGKKARKNAQPSPARAPAELEVECATQLRRFGDKLNFRQKLLNLISKLFCSGT
NT seq 165 nt NT seq  +upstreamnt  +downstreamnt
atgcctgggaagaaggcgcgcaagaacgctcaaccgagccccgcgcgggctccagcagag
ctggaagtcgagtgtgctactcaactcaggagatttggagacaaactgaacttccggcag
aaacttctgaatctgatatccaaactcttctgctcaggaacctga

DBGET integrated database retrieval system