KEGG   Homo sapiens (human): 5366Help
Entry
5366              CDS       T01001                                 

Gene name
PMAIP1, APR, NOXA
Definition
phorbol-12-myristate-13-acetate-induced protein 1
Orthology
K10131  
phorbol-12-myristate-13-acetate-induced protein 1
Organism
hsa  Homo sapiens (human)
Pathway
p53 signaling pathway
Viral carcinogenesis
Class
Cellular Processes; Cell growth and death; p53 signaling pathway [PATH:hsa04115]
Human Diseases; Cancers; Viral carcinogenesis [PATH:hsa05203]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
18q21.32
AA seq 54 aa AA seqDB search
MPGKKARKNAQPSPARAPAELEVECATQLRRFGDKLNFRQKLLNLISKLFCSGT
NT seq 165 nt NT seq  +upstreamnt  +downstreamnt
atgcctgggaagaaggcgcgcaagaacgctcaaccgagccccgcgcgggctccagcagag
ctggaagtcgagtgtgctactcaactcaggagatttggagacaaactgaacttccggcag
aaacttctgaatctgatatccaaactcttctgctcaggaacctga

DBGET integrated database retrieval system