KEGG   Homo sapiens (human): 53828Help
Entry
53828             CDS       T01001                                 

Gene name
FXYD4, CHIF
Definition
FXYD domain containing ion transport regulator 4
Orthology
K13359  
FXYD domain containing ion transport regulator 4
Organism
hsa  Homo sapiens (human)
Pathway
Aldosterone-regulated sodium reabsorption
Class
Organismal Systems; Excretory system; Aldosterone-regulated sodium reabsorption [PATH:hsa04960]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
10q11.21
AA seq 89 aa AA seqDB search
MERVTLALLLLAGLTALEANDPFANKDDPFYYDWKNLQLSGLICGGLLAIAGIAAVLSGK
CKCKSSQKQHSPVPEKAIPLITPGSATTC
NT seq 270 nt NT seq  +upstreamnt  +downstreamnt
atggagagagtgaccctggcccttctcctactggcaggcctgactgccttggaagccaat
gacccatttgccaataaagacgatcccttctactatgactggaaaaacctgcagctgagc
ggactgatctgcggagggctcctggccattgctgggatcgcggcagttctgagtggcaaa
tgcaaatgcaagagcagccagaagcagcacagtcctgtacctgagaaggccatcccactc
atcactccaggctctgccactacttgctga

DBGET integrated database retrieval system