KEGG   Homo sapiens (human): 53829Help
Entry
53829             CDS       T01001                                 

Gene name
P2RY13, FKSG77, GPCR1, GPR86, GPR94, P2Y13, SP174
Definition
(RefSeq) purinergic receptor P2Y13
  KO
K08388  
purinergic receptor P2Y, G protein-coupled, 13
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    53829 (P2RY13)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Base and nucleoside
   Purine / pyrimidine
    53829 (P2RY13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3q24
AA seq 354 aa AA seqDB search
MTAAIRRQRELSILPKVTLEAMNTTVMQGFNRSERCPRDTRIVQLVFPALYTVVFLTGIL
LNTLALWVFVHIPSSSTFIIYLKNTLVADLIMTLMLPFKILSDSHLAPWQLRAFVCRFSS
VIFYETMYVGIVLLGLIAFDRFLKIIRPLRNIFLKKPVFAKTVSIFIWFFLFFISLPNTI
LSNKEATPSSVKKCASLKGPLGLKWHQMVNNICQFIFWTVFILMLVFYVVIAKKVYDSYR
KSKSKDRKNNKKLEGKVFVVVAVFFVCFAPFHFARVPYTHSQTNNKTDCRLQNQLFIAKE
TTLFLAATNICMDPLIYIFLCKKFTEKLPCMQGRKTTASSQENHSSQTDNITLG
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgactgccgccataagaagacagagagaactgagtatcctcccaaaggtgacactggaa
gcaatgaacaccacagtgatgcaaggcttcaacagatctgagcggtgccccagagacact
cggatagtacagctggtattcccagccctctacacagtggttttcttgaccggcatcctg
ctgaatactttggctctgtgggtgtttgttcacatccccagctcctccaccttcatcatc
tacctcaaaaacactttggtggccgacttgataatgacactcatgcttcctttcaaaatc
ctctctgactcacacctggcaccctggcagctcagagcttttgtgtgtcgtttttcttcg
gtgatattttatgagaccatgtatgtgggcatcgtgctgttagggctcatagcctttgac
agattcctcaagatcatcagacctttgagaaatatttttctaaaaaaacctgtttttgca
aaaacggtctcaatcttcatctggttctttttgttcttcatctccctgccaaatacgatc
ttgagcaacaaggaagcaacaccatcgtctgtgaaaaagtgtgcttccttaaaggggcct
ctggggctgaaatggcatcaaatggtaaataacatatgccagtttattttctggactgtt
tttatcctaatgcttgtgttttatgtggttattgcaaaaaaagtatatgattcttataga
aagtccaaaagtaaggacagaaaaaacaacaaaaagctggaaggcaaagtatttgttgtc
gtggctgtcttctttgtgtgttttgctccatttcattttgccagagttccatatactcac
agtcaaaccaacaataagactgactgtagactgcaaaatcaactgtttattgctaaagaa
acaactctctttttggcagcaactaacatttgtatggatcccttaatatacatattctta
tgtaaaaaattcacagaaaagctaccatgtatgcaagggagaaagaccacagcatcaagc
caagaaaatcatagcagtcagacagacaacataaccttaggctga

DBGET integrated database retrieval system