KEGG   Homo sapiens (human): 53833Help
Entry
53833             CDS       T01001                                 

Gene name
IL20RB, DIRS1, FNDC6, IL-20R2
Definition
interleukin 20 receptor beta
Orthology
K05137  
interleukin 20 receptor beta
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    53833 (IL20RB)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    53833 (IL20RB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
3q22.3
AA seq 311 aa AA seqDB search
MQTFTMVLEEIWTSLFMWFFYALIPCLLTDEVAILPAPQNLSVLSTNMKHLLMWSPVIAP
GETVYYSVEYQGEYESLYTSHIWIPSSWCSLTEGPECDVTDDITATVPYNLRVRATLGSQ
TSAWSILKHPFNRNSTILTRPGMEITKDGFHLVIELEDLGPQFEFLVAYWRREPGAEEHV
KMVRSGGIPVHLETMEPGAAYCVKAQTFVKAIGRYSAFSQTECVEVQGEAIPLVLALFAF
VGFMLILVVVPLFVWKMGRLLQYSCCPVVVLPDTLKITNSPQKLISCRREEVDACATAVM
SPEELLRAWIS
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgcagactttcacaatggttctagaagaaatctggacaagtcttttcatgtggtttttc
tacgcattgattccatgtttgctcacagatgaagtggccattctgcctgcccctcagaac
ctctctgtactctcaaccaacatgaagcatctcttgatgtggagcccagtgatcgcgcct
ggagaaacagtgtactattctgtcgaataccagggggagtacgagagcctgtacacgagc
cacatctggatccccagcagctggtgctcactcactgaaggtcctgagtgtgatgtcact
gatgacatcacggccactgtgccatacaaccttcgtgtcagggccacattgggctcacag
acctcagcctggagcatcctgaagcatccctttaatagaaactcaaccatccttacccga
cctgggatggagatcaccaaagatggcttccacctggttattgagctggaggacctgggg
ccccagtttgagttccttgtggcctactggaggagggagcctggtgccgaggaacatgtc
aaaatggtgaggagtgggggtattccagtgcacctagaaaccatggagccaggggctgca
tactgtgtgaaggcccagacattcgtgaaggccattgggaggtacagcgccttcagccag
acagaatgtgtggaggtgcaaggagaggccattcccctggtactggccctgtttgccttt
gttggcttcatgctgatccttgtggtcgtgccactgttcgtctggaaaatgggccggctg
ctccagtactcctgttgccccgtggtggtcctcccagacaccttgaaaataaccaattca
ccccagaagttaatcagctgcagaagggaggaggtggatgcctgtgccacggctgtgatg
tctcctgaggaactcctcagggcctggatctcatag

DBGET integrated database retrieval system