KEGG   Homo sapiens (human): 53836Help
Entry
53836             CDS       T01001                                 

Gene name
GPR87, FKSG78, GPR95, KPG_002
Definition
(RefSeq) G protein-coupled receptor 87
  KO
K08389  
G protein-coupled receptor 87
Organism
hsa  Homo sapiens (human)
Brite
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Base and nucleoside
   Purine / pyrimidine
    53836 (GPR87)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3q24
AA seq 358 aa AA seqDB search
MGFNLTLAKLPNNELHGQESHNSGNRSDGPGKNTTLHNEFDTIVLPVLYLIIFVASILLN
GLAVWIFFHIRNKTSFIFYLKNIVVADLIMTLTFPFRIVHDAGFGPWYFKFILCRYTSVL
FYANMYTSIVFLGLISIDRYLKVVKPFGDSRMYSITFTKVLSVCVWVIMAVLSLPNIILT
NGQPTEDNIHDCSKLKSPLGVKWHTAVTYVNSCLFVAVLVILIGCYIAISRYIHKSSRQF
ISQSSRKRKHNQSIRVVVAVFFTCFLPYHLCRIPFTFSHLDRLLDESAQKILYYCKEITL
FLSACNVCLDPIIYFFMCRSFSRRLFKKSNIRTRSESIRSLQSVRRSEVRIYYDYTDV
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atggggttcaacttgacgcttgcaaaattaccaaataacgagctgcacggccaagagagt
cacaattcaggcaacaggagcgacgggccaggaaagaacaccacccttcacaatgaattt
gacacaattgtcttgccggtgctttatctcattatatttgtggcaagcatcttgctgaat
ggtttagcagtgtggatcttcttccacattaggaataaaaccagcttcatattctatctc
aaaaacatagtggttgcagacctcataatgacgctgacatttccatttcgaatagtccat
gatgcaggatttggaccttggtacttcaagtttattctctgcagatacacttcagttttg
ttttatgcaaacatgtatacttccatcgtgttccttgggctgataagcattgatcgctat
ctgaaggtggtcaagccatttggggactctcggatgtacagcataaccttcacgaaggtt
ttatctgtttgtgtttgggtgatcatggctgttttgtctttgccaaacatcatcctaaca
aatggtcagccaacagaggacaatatccatgactgctcaaaacttaaaagtcctttgggg
gtcaaatggcatacggcagtcacctatgtgaacagctgcttgtttgtggccgtgctggtg
attctgatcggatgttacatagccatatccaggtacatccacaaatccagcaggcaattc
ataagtcagtcaagccgaaagcgaaaacataaccagagcatcagggttgttgtggctgtg
ttttttacctgctttctaccatatcacttgtgcagaattccttttacttttagtcactta
gacaggcttttagatgaatctgcacaaaaaatcctatattactgcaaagaaattacactt
ttcttgtctgcgtgtaatgtttgcctggatccaataatttactttttcatgtgtaggtca
ttttcaagaaggctgttcaaaaaatcaaatatcagaaccaggagtgaaagcatcagatca
ctgcaaagtgtgagaagatcggaagttcgcatatattatgattacactgatgtgtag

DBGET integrated database retrieval system