KEGG   Homo sapiens (human): 53836Help
Entry
53836             CDS       T01001                                 

Gene name
GPR87, FKSG78, GPR95, KPG_002
Definition
(RefSeq) G protein-coupled receptor 87
  KO
K08389  G protein-coupled receptor 87
Organism
hsa  Homo sapiens (human)
Brite
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Base and nucleoside
   Purine / pyrimidine
    53836 (GPR87)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 Alg14 7TM_GPCR_Srx Ctr
Motif
Other DBs
NCBI-GeneID: 53836
NCBI-ProteinID: NP_076404
OMIM: 606379
HGNC: 4538
Ensembl: ENSG00000138271
Vega: OTTHUMG00000159858
Pharos: Q9BY21(Tbio)
UniProt: Q9BY21
Position
3q25.1
AA seq 358 aa AA seqDB search
MGFNLTLAKLPNNELHGQESHNSGNRSDGPGKNTTLHNEFDTIVLPVLYLIIFVASILLN
GLAVWIFFHIRNKTSFIFYLKNIVVADLIMTLTFPFRIVHDAGFGPWYFKFILCRYTSVL
FYANMYTSIVFLGLISIDRYLKVVKPFGDSRMYSITFTKVLSVCVWVIMAVLSLPNIILT
NGQPTEDNIHDCSKLKSPLGVKWHTAVTYVNSCLFVAVLVILIGCYIAISRYIHKSSRQF
ISQSSRKRKHNQSIRVVVAVFFTCFLPYHLCRIPFTFSHLDRLLDESAQKILYYCKEITL
FLSACNVCLDPIIYFFMCRSFSRRLFKKSNIRTRSESIRSLQSVRRSEVRIYYDYTDV
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atggggttcaacttgacgcttgcaaaattaccaaataacgagctgcacggccaagagagt
cacaattcaggcaacaggagcgacgggccaggaaagaacaccacccttcacaatgaattt
gacacaattgtcttgccggtgctttatctcattatatttgtggcaagcatcttgctgaat
ggtttagcagtgtggatcttcttccacattaggaataaaaccagcttcatattctatctc
aaaaacatagtggttgcagacctcataatgacgctgacatttccatttcgaatagtccat
gatgcaggatttggaccttggtacttcaagtttattctctgcagatacacttcagttttg
ttttatgcaaacatgtatacttccatcgtgttccttgggctgataagcattgatcgctat
ctgaaggtggtcaagccatttggggactctcggatgtacagcataaccttcacgaaggtt
ttatctgtttgtgtttgggtgatcatggctgttttgtctttgccaaacatcatcctaaca
aatggtcagccaacagaggacaatatccatgactgctcaaaacttaaaagtcctttgggg
gtcaaatggcatacggcagtcacctatgtgaacagctgcttgtttgtggccgtgctggtg
attctgatcggatgttacatagccatatccaggtacatccacaaatccagcaggcaattc
ataagtcagtcaagccgaaagcgaaaacataaccagagcatcagggttgttgtggctgtg
ttttttacctgctttctaccatatcacttgtgcagaattccttttacttttagtcactta
gacaggcttttagatgaatctgcacaaaaaatcctatattactgcaaagaaattacactt
ttcttgtctgcgtgtaatgtttgcctggatccaataatttactttttcatgtgtaggtca
ttttcaagaaggctgttcaaaaaatcaaatatcagaaccaggagtgaaagcatcagatca
ctgcaaagtgtgagaagatcggaagttcgcatatattatgattacactgatgtgtag

DBGET integrated database retrieval system