KEGG   Homo sapiens (human): 539Help
Entry
539               CDS       T01001                                 

Gene name
ATP5O, ATPO, OSCP
Definition
ATP synthase, H+ transporting, mitochondrial F1 complex, O subunit (EC:3.6.3.14)
Orthology
K02137  
F-type H+-transporting ATPase subunit O
Organism
hsa  Homo sapiens (human)
Pathway
Oxidative phosphorylation
Metabolic pathways
Alzheimer's disease
Parkinson's disease
Huntington's disease
Module
F-type ATPase, eukaryotes
Class
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:hsa00190]
Human Diseases; Neurodegenerative diseases; Alzheimer's disease [PATH:hsa05010]
Human Diseases; Neurodegenerative diseases; Parkinson's disease [PATH:hsa05012]
Human Diseases; Neurodegenerative diseases; Huntington's disease [PATH:hsa05016]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
21q22.11
AA seq 213 aa AA seqDB search
MAAPAVSGLSRQVRCFSTSVVRPFAKLVRPPVQVYGIEGRYATALYSAASKQNKLEQVEK
ELLRVAQILKEPKVAASVLNPYVKRSIKVKSLNDITAKERFSPLTTNLINLLAENGRLSN
TQGVVSAFSTMMSVHRGEVPCTVTSASPLEEATLSELKTVLKSFLSQGQVLKLEAKTDPS
ILGGMIVRIGEKYVDMSVKTKIQKLGRAMREIV
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atggctgccccagcagtgtccgggctctcccggcaggtgcgatgcttcagtacctctgtg
gtcagaccatttgccaagcttgtgaggcctcctgttcaggtatacggtattgaaggtcgc
tatgccacagctctttattctgctgcatcaaaacagaataagctggagcaagtagaaaag
gagttgttgagagtagcacaaatcctgaaggaacccaaagtggctgcttctgttttgaat
ccctatgtgaagcgttccattaaagtgaaaagcctaaatgacatcacagcaaaagagagg
ttctctcccctcactaccaatctgatcaatttgcttgctgaaaatggtcgattaagcaat
acccaaggagtcgtttctgccttttctaccatgatgagtgtccatcgcggagaggtacct
tgcacagtgacctctgcatctcctttagaagaagccacactctctgaattaaaaactgtc
ctcaagagcttcctaagtcaaggccaagtattgaaattggaggctaagactgatccgtca
atcttgggtggaatgattgtgcgcattggcgagaaatatgttgacatgtctgtcaagacc
aagattcagaagctgggcagggctatgcgggagattgtctaa

DBGET integrated database retrieval system