KEGG   Homo sapiens (human): 539Help
Entry
539               CDS       T01001                                 

Gene name
ATP5O, ATPO, OSCP
Definition
ATP synthase, H+ transporting, mitochondrial F1 complex, O subunit (EC:3.6.3.14)
Orthology
K02137  
F-type H+-transporting ATPase subunit O
Organism
hsa  Homo sapiens (human)
Pathway
Oxidative phosphorylation
Metabolic pathways
Alzheimer's disease
Parkinson's disease
Huntington's disease
Module
F-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    539 (ATP5O)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    539 (ATP5O)
   05012 Parkinson's disease
    539 (ATP5O)
   05016 Huntington's disease
    539 (ATP5O)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
21q22.11
AA seq 213 aa AA seqDB search
MAAPAVSGLSRQVRCFSTSVVRPFAKLVRPPVQVYGIEGRYATALYSAASKQNKLEQVEK
ELLRVAQILKEPKVAASVLNPYVKRSIKVKSLNDITAKERFSPLTTNLINLLAENGRLSN
TQGVVSAFSTMMSVHRGEVPCTVTSASPLEEATLSELKTVLKSFLSQGQVLKLEAKTDPS
ILGGMIVRIGEKYVDMSVKTKIQKLGRAMREIV
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atggctgccccagcagtgtccgggctctcccggcaggtgcgatgcttcagtacctctgtg
gtcagaccatttgccaagcttgtgaggcctcctgttcaggtatacggtattgaaggtcgc
tatgccacagctctttattctgctgcatcaaaacagaataagctggagcaagtagaaaag
gagttgttgagagtagcacaaatcctgaaggaacccaaagtggctgcttctgttttgaat
ccctatgtgaagcgttccattaaagtgaaaagcctaaatgacatcacagcaaaagagagg
ttctctcccctcactaccaatctgatcaatttgcttgctgaaaatggtcgattaagcaat
acccaaggagtcgtttctgccttttctaccatgatgagtgtccatcgcggagaggtacct
tgcacagtgacctctgcatctcctttagaagaagccacactctctgaattaaaaactgtc
ctcaagagcttcctaagtcaaggccaagtattgaaattggaggctaagactgatccgtca
atcttgggtggaatgattgtgcgcattggcgagaaatatgttgacatgtctgtcaagacc
aagattcagaagctgggcagggctatgcgggagattgtctaa

DBGET integrated database retrieval system