KEGG   Homo sapiens (human): 53918Help
Entry
53918             CDS       T01001                                 

Gene name
PELO, CGI-17, PRO1770
Definition
(RefSeq) pelota homolog (Drosophila)
  KO
K06965  
protein pelota
Organism
hsa  Homo sapiens (human)
Pathway
mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    53918 (PELO)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
Q9BRX2(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
5q11.2
AA seq 385 aa AA seqDB search
MKLVRKNIEKDNAGQVTLVPEEPEDMWHTYNLVQVGDSLRASTIRKVQTESSTGSVGSNR
VRTTLTLCVEAIDFDSQACQLRVKGTNIQENEYVKMGAYHTIELEPNRQFTLAKKQWDSV
VLERIEQACDPAWSADVAAVVMQEGLAHICLVTPSMTLTRAKVEVNIPRKRKGNCSQHDR
ALERFYEQVVQAIQRHIHFDVVKCILVASPGFVREQFCDYLFQQAVKTDNKLLLENRSKF
LQVHASSGHKYSLKEALCDPTVASRLSDTKAAGEVKALDDFYKMLQHEPDRAFYGLKQVE
KANEAMAIDTLLISDELFRHQDVATRSRYVRLVDSVKENAGTVRIFSSLHVSGEQLSQLT
GVAAILRFPVPELSDQEGDSSSEED
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgaagctcgtgaggaagaacatcgagaaggacaatgcgggccaggtgaccctggtcccc
gaggagcctgaggacatgtggcacacttacaacctcgtgcaggtgggcgacagcctgcgc
gcctccaccatccgcaaggtacagacagagtcctccacgggcagcgtgggcagcaaccgg
gtccgcactaccctcactctctgcgtggaggccatcgacttcgactctcaagcctgccag
ctgcgggttaaggggaccaacatccaagagaatgagtatgtcaagatgggggcttaccac
accatcgagctggagcccaaccgccagttcaccctggccaagaagcagtgggatagtgtg
gtactggagcgcatcgagcaggcctgtgacccagcctggagcgctgatgtggcggctgtg
gtcatgcaggaaggcctcgcccatatctgcttagtcactcccagcatgaccctcactcgg
gccaaggtggaggtgaacatccctaggaaaaggaaaggcaattgctctcagcatgaccgg
gccttggagcggttctatgaacaggtggtccaggctatccagcgccacatacactttgat
gttgtaaagtgcatcctggtggccagcccaggatttgtgagggagcagttctgcgactac
ctgtttcaacaagcagtgaagaccgacaacaaactgctcctggaaaaccggtccaaattt
cttcaggtacatgcctcctccggacacaagtactccctgaaagaggccctttgtgaccct
actgtggctagccgcctttcagacactaaagctgctggggaagtcaaagccttggatgac
ttctataaaatgttacagcatgaaccggatcgagctttctatggactcaagcaggtggag
aaggccaatgaagccatggcaattgacacattgctcatcagcgatgagctcttcaggcat
caggatgtagccacacggagccggtatgtgaggctggtggacagtgtgaaagagaatgca
ggcaccgttaggatattctctagtcttcacgtttctggggaacagctcagccagttgact
ggggtagctgccattctccgcttccctgttcccgaactttctgaccaagagggtgattcc
agttctgaagaggattaa

DBGET integrated database retrieval system