KEGG   Homo sapiens (human): 53981Help
Entry
53981             CDS       T01001                                 

Gene name
CPSF2, CPSF100
Definition
cleavage and polyadenylation specific factor 2, 100kDa
Orthology
K14402  
cleavage and polyadenylation specificity factor subunit 2
Organism
hsa  Homo sapiens (human)
Pathway
mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    53981 (CPSF2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Vega: 
UniProt: 
Position
14q31.1
AA seq 782 aa AA seqDB search
MTSIIKLTTLSGVQEESALCYLLQVDEFRFLLDCGWDEHFSMDIIDSLRKHVHQIDAVLL
SHPDPLHLGALPYAVGKLGLNCAIYATIPVYKMGQMFMYDLYQSRHNTEDFTLFTLDDVD
AAFDKIQQLKFSQIVNLKGKGHGLSITPLPAGHMIGGTIWKIVKDGEEEIVYAVDFNHKR
EIHLNGCSLEMLSRPSLLITDSFNATYVQPRRKQRDEQLLTNVLETLRGDGNVLIAVDTA
GRVLELAQLLDQIWRTKDAGLGVYSLALLNNVSYNVVEFSKSQVEWMSDKLMRCFEDKRN
NPFQFRHLSLCHGLSDLARVPSPKVVLASQPDLECGFSRDLFIQWCQDPKNSIILTYRTT
PGTLARFLIDNPSEKITEIELRKRVKLEGKELEEYLEKEKLKKEAAKKLEQSKEADIDSS
DESDIEEDIDQPSAHKTKHDLMMKGEGSRKGSFFKQAKKSYPMFPAPEERIKWDEYGEII
KPEDFLVPELQATEEEKSKLESGLTNGDEPMDQDLSDVPTKCISTTESIEIKARVTYIDY
EGRSDGDSIKKIINQMKPRQLIIVHGPPEASQDLAECCRAFGGKDIKVYMPKLHETVDAT
SETHIYQVRLKDSLVSSLQFCKAKDAELAWIDGVLDMRVSKVDTGVILEEGELKDDGEDS
EMQVEAPSDSSVIAQQKAMKSLFGDDEKETGEESEIIPTLEPLPPHEVPGHQSVFMNEPR
LSDFKQVLLREGIQAEFVGGVLVCNNQVAVRRTETGRIGLEGCLCQDFYRIRDLLYEQYA
IV
NT seq 2349 nt NT seq  +upstreamnt  +downstreamnt
atgacgtctattatcaaattaactaccctttctggggtccaagaagaatctgccctttgc
tatcttctccaagttgatgagtttagatttttattggactgtggctgggatgagcacttt
tctatggatattattgattccctgaggaagcatgttcaccagattgatgcagtgctgttg
tctcaccctgatcctctccaccttggtgccctcccgtatgctgtcggaaagttgggtctg
aactgtgctatctatgcaaccattcctgtttataaaatgggacagatgttcatgtatgat
ctttatcagtctcgacacaatacagaagattttacactctttacattagatgatgtggat
gcagcctttgataaaatacagcagctaaaattctctcagattgtgaatttgaaaggtaaa
ggacatggcctgtctatcacacctctgccagctggtcatatgataggtggaacaatatgg
aaaatagtcaaagatggagaagaagaaattgtttatgcagttgacttcaaccacaagagg
gagatccatttaaatggatgttccctggaaatgctaagcaggccttccctacttatcaca
gattcattcaatgctacatatgtacagcctagaagaaaacagagagatgagcagcttctg
acaaatgtcctggaaacacttcgaggtgatggaaatgtgttaatagcagtggacacagca
ggcagagttttggaacttgctcaacttcttgatcagatttggaggactaaagatgcagga
ttgggtgtttactcattggcactcctaaataatgtcagttacaatgtggtggagttttct
aagtcccaggtagaatggatgagtgataaattgatgagatgttttgaagacaaaagaaat
aatccgtttcagtttcgccatctctctttatgtcatggtctttctgacttggcccgtgta
cctagccctaaagttgtacttgccagccaacctgacctggaatgcggattttcaagggat
ctctttattcagtggtgtcaggaccctaaaaactcaatcattctaacctacagaactact
cctgggactttagcacgtttcctaattgataatccttctgaaaaaattacagaaatagag
ttgaggaaacgtgtgaagcttgaagggaaagaacttgaagaatacttggaaaaagagaaa
ctaaagaaagaagctgccaaaaagcttgagcagtcaaaagaggcagatatagattccagt
gatgagagtgatattgaggaagatattgaccagccatcagctcataagacgaagcatgac
ttgatgatgaaaggtgaaggcagtcgtaaaggaagttttttcaaacaggcaaaaaagtcc
tatcctatgtttcctgccccagaagaaagaattaaatgggatgaatatggagagattatc
aaaccagaggatttcttagtgccagagcttcaagctactgaagaagaaaaaagcaaatta
gaatctggtttgacaaatggagatgaacctatggatcaggatttatctgatgttcctact
aaatgtatttctacaacagagtctattgaaataaaagcccgggttacctacatagactat
gaaggacgctctgatggggattccattaaaaaaatcattaatcagatgaaaccacgacag
ttgatcatcgtccatggcccaccagaggccagtcaagatctggcagagtgctgtcgcgcc
tttggtgggaaagatattaaagtgtacatgccaaagctacatgaaacagttgatgccact
agtgaaactcacatctaccaggtgaggttaaaagactcacttgtcagctctcttcagttt
tgtaaggcaaaagatgctgaattagcttggatagatggtgtcttagatatgagagtttcc
aaagtggacacaggggttattttagaagaaggagaactaaaggatgatggagaagactca
gagatgcaagtggaagctccctcagattctagcgttatagcacaacaaaaggccatgaaa
agtctgttcggagatgatgaaaaagaaacaggtgaagaaagtgagatcattcctactttg
gaacccttgccacctcatgaggttcctggacatcagtcagtttttatgaatgaaccaagg
ctgtcagacttcaagcaagttctcttacgggaggggattcaagctgaatttgtaggaggt
gtacttgtttgcaacaatcaagtagcagtccgcagaacggaaactggacgcattggatta
gaaggctgcctttgtcaagatttttataggataagagaccttttatatgaacaatatgcc
attgtataa

DBGET integrated database retrieval system