KEGG   Homo sapiens (human): 54Help
Entry
54                CDS       T01001                                 

Gene name
ACP5, HPAP, TRACP5a, TRACP5b, TRAP, TrATPase
Definition
(RefSeq) acid phosphatase 5, tartrate resistant
  KO
K14379  
tartrate-resistant acid phosphatase type 5 [EC:3.1.3.2]
Organism
hsa  Homo sapiens (human)
Pathway
Riboflavin metabolism
Metabolic pathways
Lysosome
Osteoclast differentiation
Rheumatoid arthritis
Disease
H01576  
Spondyloenchondrodysplasia with immune dysregulation (SPENCDI)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    54 (ACP5)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    54 (ACP5)
 Organismal Systems
  Development
   04380 Osteoclast differentiation
    54 (ACP5)
 Human Diseases
  Immune diseases
   05323 Rheumatoid arthritis
    54 (ACP5)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.2  acid phosphatase
     54 (ACP5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P13686(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
19p13.2
AA seq 325 aa AA seqDB search
MDMWTALLILQALLLPSLADGATPALRFVAVGDWGGVPNAPFHTAREMANAKEIARTVQI
LGADFILSLGDNFYFTGVQDINDKRFQETFEDVFSDRSLRKVPWYVLAGNHDHLGNVSAQ
IAYSKISKRWNFPSPFYRLHFKIPQTNVSVAIFMLDTVTLCGNSDDFLSQQPERPRDVKL
ARTQLSWLKKQLAAAREDYVLVAGHYPVWSIAEHGPTHCLVKQLRPLLATYGVTAYLCGH
DHNLQYLQDENGVGYVLSGAGNFMDPSKRHQRKVPNGYLRFHYGTEDSLGGFAYVEISSK
EMTVTYIEASGKSLFKTRLPRRARP
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atggacatgtggacggcgctgctcatcctgcaagccttgttgctaccctccctggctgat
ggtgccacccctgccctgcgctttgtagccgtgggtgactggggaggggtccccaatgcc
ccattccacacggcccgggaaatggccaatgccaaggagatcgctcggactgtgcagatc
ctgggtgcagacttcatcctgtctctaggggacaatttttacttcactggtgtgcaagac
atcaatgacaagaggttccaggagacctttgaggacgtattctctgaccgctcccttcgc
aaagtgccctggtacgtgctagccggaaaccatgaccaccttggcaatgtctctgcccag
attgcatactctaagatctccaagcgctggaacttccccagccctttctaccgcctgcac
ttcaagatcccacagaccaatgtgtctgtggccatttttatgctggacacagtgacacta
tgtggcaactcagatgacttcctcagccagcagcctgagaggccccgagacgtgaagctg
gcccgcacacagctgtcctggctcaagaaacagctggcggcggccagggaggactacgtg
ctggtggctggccactaccccgtgtggtccatagccgagcacgggcctacccactgcctg
gtcaagcagctacggccactgctggccacatacggggtcactgcctacctgtgcggccac
gatcacaatctgcagtacctgcaagatgagaatggcgtgggctacgtgctgagtggggct
gggaatttcatggacccctcaaagcggcaccagcgcaaggtccccaacggctatctgcgc
ttccactatgggactgaagactcactgggtggctttgcctatgtggagatcagctccaaa
gagatgactgtcacttacatcgaggcctcgggcaagtccctctttaagaccaggctgccg
aggcgagccaggccctga

DBGET integrated database retrieval system