KEGG   Homo sapiens (human): 54Help
Entry
54                CDS       T01001                                 

Gene name
ACP5, HPAP, TRACP5a, TRACP5b, TRAP, TrATPase
Definition
(RefSeq) acid phosphatase 5, tartrate resistant (EC:3.1.3.2)
  KO
K14379  
tartrate-resistant acid phosphatase type 5 [EC:3.1.3.2]
Organism
hsa  Homo sapiens (human)
Pathway
Lysosome
Osteoclast differentiation
Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    54 (ACP5)
 Organismal Systems
  Development
   04380 Osteoclast differentiation
    54 (ACP5)
 Human Diseases
  Immune diseases
   05323 Rheumatoid arthritis
    54 (ACP5)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.2  acid phosphatase
     54 (ACP5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19p13.2
AA seq 325 aa AA seqDB search
MDMWTALLILQALLLPSLADGATPALRFVAVGDWGGVPNAPFHTAREMANAKEIARTVQI
LGADFILSLGDNFYFTGVQDINDKRFQETFEDVFSDRSLRKVPWYVLAGNHDHLGNVSAQ
IAYSKISKRWNFPSPFYRLHFKIPQTNVSVAIFMLDTVTLCGNSDDFLSQQPERPRDVKL
ARTQLSWLKKQLAAAREDYVLVAGHYPVWSIAEHGPTHCLVKQLRPLLATYGVTAYLCGH
DHNLQYLQDENGVGYVLSGAGNFMDPSKRHQRKVPNGYLRFHYGTEDSLGGFAYVEISSK
EMTVTYIEASGKSLFKTRLPRRARP
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atggacatgtggacggcgctgctcatcctgcaagccttgttgctaccctccctggctgat
ggtgccacccctgccctgcgctttgtagccgtgggtgactggggaggggtccccaatgcc
ccattccacacggcccgggaaatggccaatgccaaggagatcgctcggactgtgcagatc
ctgggtgcagacttcatcctgtctctaggggacaatttttacttcactggtgtgcaagac
atcaatgacaagaggttccaggagacctttgaggacgtattctctgaccgctcccttcgc
aaagtgccctggtacgtgctagccggaaaccatgaccaccttggcaatgtctctgcccag
attgcatactctaagatctccaagcgctggaacttccccagccctttctaccgcctgcac
ttcaagatcccacagaccaatgtgtctgtggccatttttatgctggacacagtgacacta
tgtggcaactcagatgacttcctcagccagcagcctgagaggccccgagacgtgaagctg
gcccgcacacagctgtcctggctcaagaaacagctggcggcggccagggaggactacgtg
ctggtggctggccactaccccgtgtggtccatagccgagcacgggcctacccactgcctg
gtcaagcagctacggccactgctggccacatacggggtcactgcctacctgtgcggccac
gatcacaatctgcagtacctgcaagatgagaatggcgtgggctacgtgctgagtggggct
gggaatttcatggacccctcaaagcggcaccagcgcaaggtccccaacggctatctgcgc
ttccactatgggactgaagactcactgggtggctttgcctatgtggagatcagctccaaa
gagatgactgtcacttacatcgaggcctcgggcaagtccctctttaagaccaggctgccg
aggcgagccaggccctga

DBGET integrated database retrieval system