KEGG   Homo sapiens (human): 540Help
Entry
540               CDS       T01001                                 

Gene name
ATP7B, PWD, WC1, WD, WND
Definition
(RefSeq) ATPase copper transporting beta (EC:3.6.3.54)
  KO
K17686  
Cu+-exporting ATPase [EC:3.6.3.54]
Organism
hsa  Homo sapiens (human)
Pathway
Platinum drug resistance
Disease
H00210  
Wilson disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Antineoplastic resistance
   01524 Platinum drug resistance
    540 (ATP7B)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.54  Cu+-exporting ATPase
     540 (ATP7B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
13q14.3
AA seq 1465 aa AA seqDB search
MPEQERQITAREGASRKILSKLSLPTRAWEPAMKKSFAFDNVGYEGGLDGLGPSSQVATS
TVRILGMTCQSCVKSIEDRISNLKGIISMKVSLEQGSATVKYVPSVVCLQQVCHQIGDMG
FEASIAEGKAASWPSRSLPAQEAVVKLRVEGMTCQSCVSSIEGKVRKLQGVVRVKVSLSN
QEAVITYQPYLIQPEDLRDHVNDMGFEAAIKSKVAPLSLGPIDIERLQSTNPKRPLSSAN
QNFNNSETLGHQGSHVVTLQLRIDGMHCKSCVLNIEENIGQLLGVQSIQVSLENKTAQVK
YDPSCTSPVALQRAIEALPPGNFKVSLPDGAEGSGTDHRSSSSHSPGSPPRNQVQGTCST
TLIAIAGMTCASCVHSIEGMISQLEGVQQISVSLAEGTATVLYNPSVISPEELRAAIEDM
GFEASVVSESCSTNPLGNHSAGNSMVQTTDGTPTSVQEVAPHTGRLPANHAPDILAKSPQ
STRAVAPQKCFLQIKGMTCASCVSNIERNLQKEAGVLSVLVALMAGKAEIKYDPEVIQPL
EIAQFIQDLGFEAAVMEDYAGSDGNIELTITGMTCASCVHNIESKLTRTNGITYASVALA
TSKALVKFDPEIIGPRDIIKIIEEIGFHASLAQRNPNAHHLDHKMEIKQWKKSFLCSLVF
GIPVMALMIYMLIPSNEPHQSMVLDHNIIPGLSILNLIFFILCTFVQLLGGWYFYVQAYK
SLRHRSANMDVLIVLATSIAYVYSLVILVVAVAEKAERSPVTFFDTPPMLFVFIALGRWL
EHLAKSKTSEALAKLMSLQATEATVVTLGEDNLIIREEQVPMELVQRGDIVKVVPGGKFP
VDGKVLEGNTMADESLITGEAMPVTKKPGSTVIAGSINAHGSVLIKATHVGNDTTLAQIV
KLVEEAQMSKAPIQQLADRFSGYFVPFIIIMSTLTLVVWIVIGFIDFGVVQRYFPNPNKH
ISQTEVIIRFAFQTSITVLCIACPCSLGLATPTAVMVGTGVAAQNGILIKGGKPLEMAHK
IKTVMFDKTGTITHGVPRVMRVLLLGDVATLPLRKVLAVVGTAEASSEHPLGVAVTKYCK
EELGTETLGYCTDFQAVPGCGIGCKVSNVEGILAHSERPLSAPASHLNEAGSLPAEKDAV
PQTFSVLIGNREWLRRNGLTISSDVSDAMTDHEMKGQTAILVAIDGVLCGMIAIADAVKQ
EAALAVHTLQSMGVDVVLITGDNRKTARAIATQVGINKVFAEVLPSHKVAKVQELQNKGK
KVAMVGDGVNDSPALAQADMGVAIGTGTDVAIEAADVVLIRNDLLDVVASIHLSKRTVRR
IRINLVLALIYNLVGIPIAAGVFMPIGIVLQPWMGSAAMAASSVSVVLSSLQLKCYKKPD
LERYEAQAHGHMKPLTASQVSVHIGMDDRWRDSPRATPWDQVSYVSQVSLSSLTSDKPSR
HSAAADDDGDKWSLLLNGRDEEQYI
NT seq 4398 nt NT seq  +upstreamnt  +downstreamnt
atgcctgagcaggagagacagatcacagccagagaaggggccagtcggaaaatcttatct
aagctttctttgcctacccgtgcctgggaaccagcaatgaagaagagttttgcttttgac
aatgttggctatgaaggtggtctggatggcctgggcccttcttctcaggtggccaccagc
acagtcaggatcttgggcatgacttgccagtcatgtgtgaagtccattgaggacaggatt
tccaatttgaaaggcatcatcagcatgaaggtttccctggaacaaggcagtgccactgtg
aaatatgtgccatcggttgtgtgcctgcaacaggtttgccatcaaattggggacatgggc
ttcgaggccagcattgcagaaggaaaggcagcctcctggccctcaaggtccttgcctgcc
caggaggctgtggtcaagctccgggtggagggcatgacctgccagtcctgtgtcagctcc
attgaaggcaaggtccggaaactgcaaggagtagtgagagtcaaagtctcactcagcaac
caagaggccgtcatcacttatcagccttatctcattcagcccgaagacctcagggaccat
gtaaatgacatgggatttgaagctgccatcaagagcaaagtggctcccttaagcctggga
ccaattgatattgagcggttacaaagcactaacccaaagagacctttatcttctgctaac
cagaattttaataattctgagaccttggggcaccaaggaagccatgtggtcaccctccaa
ctgagaatagatggaatgcattgtaagtcttgcgtcttgaatattgaagaaaatattggc
cagctcctaggggttcaaagtattcaagtgtccttggagaacaaaactgcccaagtaaag
tatgacccttcttgtaccagcccagtggctctgcagagggctatcgaggcacttccacct
gggaattttaaagtttctcttcctgatggagccgaagggagtgggacagatcacaggtct
tccagttctcattcccctggctccccaccgagaaaccaggtccagggcacatgcagtacc
actctgattgccattgccggcatgacctgtgcatcctgtgtccattccattgaaggcatg
atctcccaactggaaggggtgcagcaaatatcggtgtctttggccgaagggactgcaaca
gttctttataatccctctgtaattagcccagaagaactcagagctgctatagaagacatg
ggatttgaggcttcagtcgtttctgaaagctgttctactaaccctcttggaaaccacagt
gctgggaattccatggtgcaaactacagatggtacacctacatctgtgcaggaagtggct
ccccacactgggaggctccctgcaaaccatgccccggacatcttggcaaagtccccacaa
tcaaccagagcagtggcaccgcagaagtgcttcttacagatcaaaggcatgacctgtgca
tcctgtgtgtctaacatagaaaggaatctgcagaaagaagctggtgttctctccgtgttg
gttgccttgatggcaggaaaggcagagatcaagtatgacccagaggtcatccagcccctc
gagatagctcagttcatccaggacctgggttttgaggcagcagtcatggaggactacgca
ggctccgatggcaacattgagctgacaatcacagggatgacctgcgcgtcctgtgtccac
aacatagagtccaaactcacgaggacaaatggcatcacttatgcctccgttgcccttgcc
accagcaaagcccttgttaagtttgacccggaaattatcggtccacgggatattatcaaa
attattgaggaaattggctttcatgcttccctggcccagagaaaccccaacgctcatcac
ttggaccacaagatggaaataaagcagtggaagaagtctttcctgtgcagcctggtgttt
ggcatccctgtcatggccttaatgatctatatgctgatacccagcaacgagccccaccag
tccatggtcctggaccacaacatcattccaggactgtccattctaaatctcatcttcttt
atcttgtgtacctttgtccagctcctcggtgggtggtacttctacgttcaggcctacaaa
tctctgagacacaggtcagccaacatggacgtgctcatcgtcctggccacaagcattgct
tatgtttattctctggtcatcctggtggttgctgtggctgagaaggcggagaggagccct
gtgacattcttcgacacgccccccatgctctttgtgttcattgccctgggccggtggctg
gaacacttggcaaagagcaaaacctcagaagccctggctaaactcatgtctctccaagcc
acagaagccaccgttgtgacccttggtgaggacaatttaatcatcagggaggagcaagtc
cccatggagctggtgcagcggggcgatatcgtcaaggtggtccctgggggaaagtttcca
gtggatgggaaagtcctggaaggcaataccatggctgatgagtccctcatcacaggagaa
gccatgccagtcactaagaaacccggaagcactgtaattgcggggtctataaatgcacat
ggctctgtgctcattaaagctacccacgtgggcaatgacaccactttggctcagattgtg
aaactggtggaagaggctcagatgtcaaaggcacccattcagcagctggctgaccggttt
agtggatattttgtcccatttatcatcatcatgtcaactttgacgttggtggtatggatt
gtaatcggttttatcgattttggtgttgttcagagatactttcctaaccccaacaagcac
atctcccagacagaggtgatcatccggtttgctttccagacgtccatcacggtgctgtgc
attgcctgcccctgctccctggggctggccacgcccacggctgtcatggtgggcaccggg
gtggccgcgcagaacggcatcctcatcaagggaggcaagcccctggagatggcgcacaag
ataaagactgtgatgtttgacaagactggcaccattacccatggcgtccccagggtcatg
cgggtgctcctgctgggggatgtggccacactgcccctcaggaaggttctggctgtggtg
gggactgcggaggccagcagtgaacaccccttgggcgtggcagtcaccaaatactgtaaa
gaggaacttggaacagagaccttgggatactgcacggacttccaggcagtgccaggctgt
ggaattgggtgcaaagtcagcaacgtggaaggcatcctggcccacagtgagcgccctttg
agtgcaccggccagtcacctgaatgaggctggcagccttcccgcagaaaaagatgcagtc
ccccagaccttctctgtgctgattggaaaccgtgagtggctgaggcgcaacggtttaacc
atttctagcgatgtcagtgacgctatgacagaccacgagatgaaaggacagacagccatc
ctggtggctattgacggtgtgctctgtgggatgatcgcaatcgcagacgctgtcaagcag
gaggctgccctggctgtgcacacgctgcagagcatgggtgtggacgtggttctgatcacg
ggggacaaccggaagacagccagagctattgccacccaggttggcatcaacaaagtcttt
gcagaggtgctgccttcgcacaaggtggccaaggtccaggagctccagaataaagggaag
aaagtcgccatggtgggggatggggtcaatgactccccggccttggcccaggcagacatg
ggtgtggccattggcaccggcacggatgtggccatcgaggcagccgacgtcgtccttatc
agaaatgatttgctggatgtggtggctagcattcacctttccaagaggactgtccgaagg
atacgcatcaacctggtcctggcactgatttataacctggttgggatacccattgcagca
ggtgtcttcatgcccatcggcattgtgctgcagccctggatgggctcagcggccatggca
gcctcctctgtgtctgtggtgctctcatccctgcagctcaagtgctataagaagcctgac
ctggagaggtatgaggcacaggcgcatggccacatgaagcccctgacggcatcccaggtc
agtgtgcacataggcatggatgacaggtggcgggactcccccagggccacaccatgggac
caggtcagctatgtcagccaggtgtcgctgtcctccctgacgtccgacaagccatctcgg
cacagcgctgcagcagacgatgatggggacaagtggtctctgctcctgaatggcagggat
gaggagcagtacatctga

DBGET integrated database retrieval system