KEGG   Homo sapiens (human): 5409Help
Entry
5409              CDS       T01001                                 

Gene name
PNMT, PENT, PNMTase
Definition
(RefSeq) phenylethanolamine N-methyltransferase
  KO
K00553  
phenylethanolamine N-methyltransferase [EC:2.1.1.28]
Organism
hsa  Homo sapiens (human)
Pathway
Tyrosine metabolism
Metabolic pathways
Module
Catecholamine biosynthesis, tyrosine => dopamine => noradrenaline => adrenaline
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    5409 (PNMT)
Enzymes [BR:hsa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.28  phenylethanolamine N-methyltransferase
     5409 (PNMT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
P11086(Tchem)
UniProt: 
Structure
PDB: 

Jmol
Position
17q12
AA seq 282 aa AA seqDB search
MSGADRSPNAGAAPDSAPGQAAVASAYQRFEPRAYLRNNYAPPRGDLCNPNGVGPWKLRC
LAQTFATGEVSGRTLIDIGSGPTVYQLLSACSHFEDITMTDFLEVNRQELGRWLQEEPGA
FNWSMYSQHACLIEGKGECWQDKERQLRARVKRVLPIDVHQPQPLGAGSPAPLPADALVS
AFCLEAVSPDLASFQRALDHITTLLRPGGHLLLIGALEESWYLAGEARLTVVPVSEEEVR
EALVRSGYKVRDLRTYIMPAHLQTGVDDVKGVFFAWAQKVGL
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcgcagaccgtagccccaatgcgggcgcagcccctgactcggccccgggccag
gcggcggtggcttcggcctaccagcgcttcgagccgcgcgcctacctccgcaacaactac
gcgccccctcgcggggacctgtgcaacccgaacggcgtcgggccgtggaagctgcgctgc
ttggcgcagaccttcgccaccggtgaagtgtccggacgcaccctcatcgacattggttca
ggccccaccgtgtaccagctgctcagtgcctgcagccactttgaggacatcaccatgaca
gatttcctggaggtcaaccgccaggagctggggcgctggctgcaggaggagccgggggcc
ttcaactggagcatgtacagccaacatgcctgcctcattgagggcaagggggaatgctgg
caggataaggagcgccagctgcgagccagggtgaaacgggtcctgcccatcgacgtgcac
cagccccagcccctgggtgctgggagcccagctcccctgcctgctgacgccctggtctct
gccttctgcttggaggctgtgagcccagatcttgccagctttcagcgggccctggaccac
atcaccacgctgctgaggcctggggggcacctcctcctcatcggggccctggaggagtcg
tggtacctggctggggaggccaggctgacggtggtgccagtgtctgaggaggaggtgagg
gaggccctggtgcgtagtggctacaaggtccgggacctccgcacctatatcatgcctgcc
caccttcagacaggcgtagatgatgtcaagggcgtcttcttcgcctgggctcagaaggtt
gggctgtga

DBGET integrated database retrieval system