KEGG   Homo sapiens (human): 54103Help
Entry
54103             CDS       T01001                                 

Gene name
GSAP, PION
Definition
(RefSeq) gamma-secretase activating protein
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
A4D1B5(Tbio)
UniProt: 
Position
7q11.23
AA seq 854 aa AA seqDB search
MALRLVADFDLGKDVLPWLRAQRAVSEASGAGSGGADVLENDYESLHVLNVERNGNIIYT
YKDDKGNVVFGLYDCQTRQNELLYTFEKDLQVFSCSVNSERTLLAASLVQSTKEGKRNEL
QPGSKCLTLLVEIHPVNNVKVLKAVDSYIWVQFLYPHIESHPLPENHLLLISEEKYIEQF
RIHVAQEDGNRVVIKNSGHLPRDRIAEDFVWAQWDMSEQRLYYIDLKKSRSILKCIQFYA
DESYNLMFEVPLDISLSNSGFKLVNFGCDYHQYRDKFSKHLTLCVFTNHTGSLCVCYSPK
CASWGQITYSVFYIHKGHSKTFTTSLENVGSHMTKGITFLNLDYYVAVYLPGHFFHLLNV
QHPDLICHNLFLTGNNEMIDMLPHCPLQSLSGSLVLDCCSGKLYRALLSQSSLLQLLQNT
CLDCEKMAALHCALYCGQGAQFLEAQIIQWISENVSACHSFDLIQEFIIASSYWSVYSET
SNMDKLLPHSSVLTWNTEIPGITLVTEDIALPLMKVLSFKGYWEKLNSNLEYVKYAKPHF
HYNNSVVRREWHNLISEEKTGKRRSAAYVRNILDNAVKVISNLEARNLGPRLTPLLQEED
SHQRLLMGLMVSELKDHFLRHLQGVEKKKIEQMVLDYISKLLDLICHIVETNWRKHNLHS
WVLHFNSRGSAAEFAVFHIMTRILEATNSLFLPLPPGFHTLHTILGVQCLPLHNLLHCID
SGVLLLTETAVIRLMKDLDNTEKNEKLKFSIIVRLPPLIGQKICRLWDHPMSSNIISRNH
VTRLLQNYKKQPRNSMINKSSFSVEFLPLNYFIEILTDIESSNQALYPFEGHDNVDAEFV
EEAALKHTAMLLGL
NT seq 2565 nt NT seq  +upstreamnt  +downstreamnt
atggctcttcgcctggtcgccgacttcgacctcgggaaggacgtgctcccgtggttgcgg
gcgcagcgggcagtgtcggaggccagcggggccggaagcggcggcgcagatgttttagaa
aacgattatgagagcttacatgtattaaatgttgaaagaaatggaaatattatttatacc
tataaggatgataagggaaatgtcgtctttggattatatgattgtcaaaccagacaaaat
gagcttctatatacctttgagaaagacttgcaagttttcagttgctctgtcaacagtgaa
aggactttgcttgctgcaagtttagttcagtctactaaagaaggaaaaaggaacgaactt
caaccaggatcaaagtgcttgactttgttggttgaaatccaccctgttaacaatgtgaag
gttctaaaggctgtggatagctatatttgggttcagtttctctacccacatattgaaagt
catcctcttccagagaaccatctgttactgatttcagaagagaaatatattgaacaattt
cgtatccatgtcgcccaagaagatggaaatagagtggtgattaaaaattctggccatctc
ccaagagacagaatagctgaggatttcgtttgggctcagtgggatatgtcagaacagaga
ttatattacattgacctgaagaaatcaaggagtatcttaaaatgtatccagttttatgct
gatgagagctataacttaatgtttgaagtacccttggacatatcattaagcaactcagga
tttaaacttgtcaactttggatgtgattatcatcaataccgagataaattttccaaacac
ctgactctgtgtgtttttaccaaccatacaggaagtttgtgtgtatgttacagcccgaag
tgtgcctcttggggacaaatcacatattcagtgttttacattcataaaggacacagcaag
accttcaccacttctcttgagaatgttgggtcacacatgacaaagggcattacttttctc
aaccttgactattatgtggctgtttacttacctggtcatttcttccacctacttaatgtt
caacatccagacctgatctgccacaatctctttctgacaggaaataatgaaatgattgat
atgctacctcattgccctttacagtcattgtcagggtccctggtattggattgttgttct
ggaaagctctatagagcactgctcagccagtcgtctttattacagcttctgcagaacact
tgcttagactgtgagaagatggctgcgttgcactgcgcgctctactgcggtcaaggtgcg
cagttcctggaagcccagattattcagtggatttctgagaatgtctctgcctgccattca
tttgacctcattcaggaatttataattgcttcttcatactggagtgtatattcagagaca
agtaacatggacaaactattgccacattcctcagtgctcacttggaatacagaaattcct
ggaataactcttgtgacagaagacattgcattgcctcttatgaaggtgctcagctttaag
ggctactgggaaaaactgaactccaacctagaatatgttaagtacgccaagccacacttc
cactataacaacagtgtggtcaggagagagtggcacaacctgatctctgaagagaaaaca
ggaaaaagaaggtctgcggcatacgtgaggaatattcttgataatgcagtaaaggtgatt
tctaacctagaagcaagaaatttggggccaagattaacacccctcctgcaggaggaagac
agccaccagcggctgctcatggggctgatggtgtctgagctaaaagaccattttttgaga
cacctacagggtgtagaaaagaagaaaattgaacagatggttctggactacatttcaaaa
ctgctggatctcatttgccacatcgtagaaaccaattggaggaaacataatcttcattcc
tgggttctccacttcaatagtcgtggcagtgctgctgaatttgcagtttttcacatcatg
accaggattctggaagctacaaacagtttgtttttacctctgcctcctggttttcatact
ctgcacaccatcctcggggtccagtgtctccctttgcataacctgctgcattgcattgac
agtggagtgttgcttctcactgaaacagctgtcataaggctcatgaaagatctggataat
acagagaaaaatgaaaaactgaaattcagtatcattgtgcggcttcctccgcttattggg
cagaagatttgtagactttgggatcatcctatgagttctaacatcatttcgcggaaccac
gtgacgcgactgcttcagaactataagaaacagcctcggaattctatgattaacaagtca
tcgttcagtgtagaatttctgcctctgaactacttcattgaaattctgacagatatagag
tcctccaatcaagccctgtatccttttgaaggacatgacaatgtggatgcagaatttgta
gaggaagcagctctgaaacacaccgcgatgcttttaggcttatga

DBGET integrated database retrieval system