KEGG   Homo sapiens (human): 54106Help
Entry
54106             CDS       T01001                                 

Gene name
TLR9, CD289
Definition
toll-like receptor 9
Orthology
K10161  
toll-like receptor 9
Organism
hsa  Homo sapiens (human)
Pathway
Toll-like receptor signaling pathway
Chagas disease (American trypanosomiasis)
African trypanosomiasis
Malaria
Tuberculosis
Measles
Herpes simplex infection
Disease
H01358  
Atopic dermatitis
Drug target
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    54106 (TLR9)
 Human Diseases
  Infectious diseases
   05152 Tuberculosis
    54106 (TLR9)
   05162 Measles
    54106 (TLR9)
   05168 Herpes simplex infection
    54106 (TLR9)
   05144 Malaria
    54106 (TLR9)
   05142 Chagas disease (American trypanosomiasis)
    54106 (TLR9)
   05143 African trypanosomiasis
    54106 (TLR9)
Cellular antigens [BR:hsa04090]
 Proteins
  54106 (TLR9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3p21.3
AA seq 1032 aa AA seqDB search
MGFCRSALHPLSLLVQAIMLAMTLALGTLPAFLPCELQPHGLVNCNWLFLKSVPHFSMAA
PRGNVTSLSLSSNRIHHLHDSDFAHLPSLRHLNLKWNCPPVGLSPMHFPCHMTIEPSTFL
AVPTLEELNLSYNNIMTVPALPKSLISLSLSHTNILMLDSASLAGLHALRFLFMDGNCYY
KNPCRQALEVAPGALLGLGNLTHLSLKYNNLTVVPRNLPSSLEYLLLSYNRIVKLAPEDL
ANLTALRVLDVGGNCRRCDHAPNPCMECPRHFPQLHPDTFSHLSRLEGLVLKDSSLSWLN
ASWFRGLGNLRVLDLSENFLYKCITKTKAFQGLTQLRKLNLSFNYQKRVSFAHLSLAPSF
GSLVALKELDMHGIFFRSLDETTLRPLARLPMLQTLRLQMNFINQAQLGIFRAFPGLRYV
DLSDNRISGASELTATMGEADGGEKVWLQPGDLAPAPVDTPSSEDFRPNCSTLNFTLDLS
RNNLVTVQPEMFAQLSHLQCLRLSHNCISQAVNGSQFLPLTGLQVLDLSHNKLDLYHEHS
FTELPRLEALDLSYNSQPFGMQGVGHNFSFVAHLRTLRHLSLAHNNIHSQVSQQLCSTSL
RALDFSGNALGHMWAEGDLYLHFFQGLSGLIWLDLSQNRLHTLLPQTLRNLPKSLQVLRL
RDNYLAFFKWWSLHFLPKLEVLDLAGNQLKALTNGSLPAGTRLRRLDVSCNSISFVAPGF
FSKAKELRELNLSANALKTVDHSWFGPLASALQILDVSANPLHCACGAAFMDFLLEVQAA
VPGLPSRVKCGSPGQLQGLSIFAQDLRLCLDEALSWDCFALSLLAVALGLGVPMLHHLCG
WDLWYCFHLCLAWLPWRGRQSGRDEDALPYDAFVVFDKTQSAVADWVYNELRGQLEECRG
RWALRLCLEERDWLPGKTLFENLWASVYGSRKTLFVLAHTDRVSGLLRASFLLAQQRLLE
DRKDVVVLVILSPDGRRSRYVRLRQRLCRQSVLLWPHQPSGQRSFWAQLGMALTRDNHHF
YNRNFCQGPTAE
NT seq 3099 nt NT seq  +upstreamnt  +downstreamnt
atgggtttctgccgcagcgccctgcacccgctgtctctcctggtgcaggccatcatgctg
gccatgaccctggccctgggtaccttgcctgccttcctaccctgtgagctccagccccac
ggcctggtgaactgcaactggctgttcctgaagtctgtgccccacttctccatggcagca
ccccgtggcaatgtcaccagcctttccttgtcctccaaccgcatccaccacctccatgat
tctgactttgcccacctgcccagcctgcggcatctcaacctcaagtggaactgcccgccg
gttggcctcagccccatgcacttcccctgccacatgaccatcgagcccagcaccttcttg
gctgtgcccaccctggaagagctaaacctgagctacaacaacatcatgactgtgcctgcg
ctgcccaaatccctcatatccctgtccctcagccataccaacatcctgatgctagactct
gccagcctcgccggcctgcatgccctgcgcttcctattcatggacggcaactgttattac
aagaacccctgcaggcaggcactggaggtggccccgggtgccctccttggcctgggcaac
ctcacccacctgtcactcaagtacaacaacctcactgtggtgccccgcaacctgccttcc
agcctggagtatctgctgttgtcctacaaccgcatcgtcaaactggcgcctgaggacctg
gccaatctgaccgccctgcgtgtgctcgatgtgggcggaaattgccgccgctgcgaccac
gctcccaacccctgcatggagtgccctcgtcacttcccccagctacatcccgataccttc
agccacctgagccgtcttgaaggcctggtgttgaaggacagttctctctcctggctgaat
gccagttggttccgtgggctgggaaacctccgagtgctggacctgagtgagaacttcctc
tacaaatgcatcactaaaaccaaggccttccagggcctaacacagctgcgcaagcttaac
ctgtccttcaattaccaaaagagggtgtcctttgcccacctgtctctggccccttccttc
gggagcctggtcgccctgaaggagctggacatgcacggcatcttcttccgctcactcgat
gagaccacgctccggccactggcccgcctgcccatgctccagactctgcgtctgcagatg
aacttcatcaaccaggcccagctcggcatcttcagggccttccctggcctgcgctacgtg
gacctgtcggacaaccgcatcagcggagcttcggagctgacagccaccatgggggaggca
gatggaggggagaaggtctggctgcagcctggggaccttgctccggccccagtggacact
cccagctctgaagacttcaggcccaactgcagcaccctcaacttcaccttggatctgtca
cggaacaacctggtgaccgtgcagccggagatgtttgcccagctctcgcacctgcagtgc
ctgcgcctgagccacaactgcatctcgcaggcagtcaatggctcccagttcctgccgctg
accggtctgcaggtgctagacctgtcccacaataagctggacctctaccacgagcactca
ttcacggagctaccgcgactggaggccctggacctcagctacaacagccagccctttggc
atgcagggcgtgggccacaacttcagcttcgtggctcacctgcgcaccctgcgccacctc
agcctggcccacaacaacatccacagccaagtgtcccagcagctctgcagtacgtcgctg
cgggccctggacttcagcggcaatgcactgggccatatgtgggccgagggagacctctat
ctgcacttcttccaaggcctgagcggtttgatctggctggacttgtcccagaaccgcctg
cacaccctcctgccccaaaccctgcgcaacctccccaagagcctacaggtgctgcgtctc
cgtgacaattacctggccttctttaagtggtggagcctccacttcctgcccaaactggaa
gtcctcgacctggcaggaaaccagctgaaggccctgaccaatggcagcctgcctgctggc
acccggctccggaggctggatgtcagctgcaacagcatcagcttcgtggcccccggcttc
ttttccaaggccaaggagctgcgagagctcaaccttagcgccaacgccctcaagacagtg
gaccactcctggtttgggcccctggcgagtgccctgcaaatactagatgtaagcgccaac
cctctgcactgcgcctgtggggcggcctttatggacttcctgctggaggtgcaggctgcc
gtgcccggtctgcccagccgggtgaagtgtggcagtccgggccagctccagggcctcagc
atctttgcacaggacctgcgcctctgcctggatgaggccctctcctgggactgtttcgcc
ctctcgctgctggctgtggctctgggcctgggtgtgcccatgctgcatcacctctgtggc
tgggacctctggtactgcttccacctgtgcctggcctggcttccctggcgggggcggcaa
agtgggcgagatgaggatgccctgccctacgatgccttcgtggtcttcgacaaaacgcag
agcgcagtggcagactgggtgtacaacgagcttcgggggcagctggaggagtgccgtggg
cgctgggcactccgcctgtgcctggaggaacgcgactggctgcctggcaaaaccctcttt
gagaacctgtgggcctcggtctatggcagccgcaagacgctgtttgtgctggcccacacg
gaccgggtcagtggtctcttgcgcgccagcttcctgctggcccagcagcgcctgctggag
gaccgcaaggacgtcgtggtgctggtgatcctgagccctgacggccgccgctcccgctac
gtgcggctgcgccagcgcctctgccgccagagtgtcctcctctggccccaccagcccagt
ggtcagcgcagcttctgggcccagctgggcatggccctgaccagggacaaccaccacttc
tataaccggaacttctgccagggacccacggccgaatag

DBGET integrated database retrieval system