KEGG   Homo sapiens (human): 54106Help
Entry
54106             CDS       T01001                                 

Gene name
TLR9, CD289
Definition
toll-like receptor 9
Orthology
K10161  
toll-like receptor 9
Organism
hsa  Homo sapiens (human)
Pathway
Toll-like receptor signaling pathway
Chagas disease (American trypanosomiasis)
African trypanosomiasis
Malaria
Tuberculosis
Measles
Herpes simplex infection
Disease
H01358  
Atopic dermatitis
Drug target
Other: 
Class
Organismal Systems; Immune system; Toll-like receptor signaling pathway [PATH:hsa04620]
Human Diseases; Infectious diseases; Tuberculosis [PATH:hsa05152]
Human Diseases; Infectious diseases; Measles [PATH:hsa05162]
Human Diseases; Infectious diseases; Herpes simplex infection [PATH:hsa05168]
Human Diseases; Infectious diseases; Malaria [PATH:hsa05144]
Human Diseases; Infectious diseases; Chagas disease (American trypanosomiasis) [PATH:hsa05142]
Human Diseases; Infectious diseases; African trypanosomiasis [PATH:hsa05143]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3p21.3
AA seq 1032 aa AA seqDB search
MGFCRSALHPLSLLVQAIMLAMTLALGTLPAFLPCELQPHGLVNCNWLFLKSVPHFSMAA
PRGNVTSLSLSSNRIHHLHDSDFAHLPSLRHLNLKWNCPPVGLSPMHFPCHMTIEPSTFL
AVPTLEELNLSYNNIMTVPALPKSLISLSLSHTNILMLDSASLAGLHALRFLFMDGNCYY
KNPCRQALEVAPGALLGLGNLTHLSLKYNNLTVVPRNLPSSLEYLLLSYNRIVKLAPEDL
ANLTALRVLDVGGNCRRCDHAPNPCMECPRHFPQLHPDTFSHLSRLEGLVLKDSSLSWLN
ASWFRGLGNLRVLDLSENFLYKCITKTKAFQGLTQLRKLNLSFNYQKRVSFAHLSLAPSF
GSLVALKELDMHGIFFRSLDETTLRPLARLPMLQTLRLQMNFINQAQLGIFRAFPGLRYV
DLSDNRISGASELTATMGEADGGEKVWLQPGDLAPAPVDTPSSEDFRPNCSTLNFTLDLS
RNNLVTVQPEMFAQLSHLQCLRLSHNCISQAVNGSQFLPLTGLQVLDLSHNKLDLYHEHS
FTELPRLEALDLSYNSQPFGMQGVGHNFSFVAHLRTLRHLSLAHNNIHSQVSQQLCSTSL
RALDFSGNALGHMWAEGDLYLHFFQGLSGLIWLDLSQNRLHTLLPQTLRNLPKSLQVLRL
RDNYLAFFKWWSLHFLPKLEVLDLAGNQLKALTNGSLPAGTRLRRLDVSCNSISFVAPGF
FSKAKELRELNLSANALKTVDHSWFGPLASALQILDVSANPLHCACGAAFMDFLLEVQAA
VPGLPSRVKCGSPGQLQGLSIFAQDLRLCLDEALSWDCFALSLLAVALGLGVPMLHHLCG
WDLWYCFHLCLAWLPWRGRQSGRDEDALPYDAFVVFDKTQSAVADWVYNELRGQLEECRG
RWALRLCLEERDWLPGKTLFENLWASVYGSRKTLFVLAHTDRVSGLLRASFLLAQQRLLE
DRKDVVVLVILSPDGRRSRYVRLRQRLCRQSVLLWPHQPSGQRSFWAQLGMALTRDNHHF
YNRNFCQGPTAE
NT seq 3099 nt NT seq  +upstreamnt  +downstreamnt
atgggtttctgccgcagcgccctgcacccgctgtctctcctggtgcaggccatcatgctg
gccatgaccctggccctgggtaccttgcctgccttcctaccctgtgagctccagccccac
ggcctggtgaactgcaactggctgttcctgaagtctgtgccccacttctccatggcagca
ccccgtggcaatgtcaccagcctttccttgtcctccaaccgcatccaccacctccatgat
tctgactttgcccacctgcccagcctgcggcatctcaacctcaagtggaactgcccgccg
gttggcctcagccccatgcacttcccctgccacatgaccatcgagcccagcaccttcttg
gctgtgcccaccctggaagagctaaacctgagctacaacaacatcatgactgtgcctgcg
ctgcccaaatccctcatatccctgtccctcagccataccaacatcctgatgctagactct
gccagcctcgccggcctgcatgccctgcgcttcctattcatggacggcaactgttattac
aagaacccctgcaggcaggcactggaggtggccccgggtgccctccttggcctgggcaac
ctcacccacctgtcactcaagtacaacaacctcactgtggtgccccgcaacctgccttcc
agcctggagtatctgctgttgtcctacaaccgcatcgtcaaactggcgcctgaggacctg
gccaatctgaccgccctgcgtgtgctcgatgtgggcggaaattgccgccgctgcgaccac
gctcccaacccctgcatggagtgccctcgtcacttcccccagctacatcccgataccttc
agccacctgagccgtcttgaaggcctggtgttgaaggacagttctctctcctggctgaat
gccagttggttccgtgggctgggaaacctccgagtgctggacctgagtgagaacttcctc
tacaaatgcatcactaaaaccaaggccttccagggcctaacacagctgcgcaagcttaac
ctgtccttcaattaccaaaagagggtgtcctttgcccacctgtctctggccccttccttc
gggagcctggtcgccctgaaggagctggacatgcacggcatcttcttccgctcactcgat
gagaccacgctccggccactggcccgcctgcccatgctccagactctgcgtctgcagatg
aacttcatcaaccaggcccagctcggcatcttcagggccttccctggcctgcgctacgtg
gacctgtcggacaaccgcatcagcggagcttcggagctgacagccaccatgggggaggca
gatggaggggagaaggtctggctgcagcctggggaccttgctccggccccagtggacact
cccagctctgaagacttcaggcccaactgcagcaccctcaacttcaccttggatctgtca
cggaacaacctggtgaccgtgcagccggagatgtttgcccagctctcgcacctgcagtgc
ctgcgcctgagccacaactgcatctcgcaggcagtcaatggctcccagttcctgccgctg
accggtctgcaggtgctagacctgtcccacaataagctggacctctaccacgagcactca
ttcacggagctaccgcgactggaggccctggacctcagctacaacagccagccctttggc
atgcagggcgtgggccacaacttcagcttcgtggctcacctgcgcaccctgcgccacctc
agcctggcccacaacaacatccacagccaagtgtcccagcagctctgcagtacgtcgctg
cgggccctggacttcagcggcaatgcactgggccatatgtgggccgagggagacctctat
ctgcacttcttccaaggcctgagcggtttgatctggctggacttgtcccagaaccgcctg
cacaccctcctgccccaaaccctgcgcaacctccccaagagcctacaggtgctgcgtctc
cgtgacaattacctggccttctttaagtggtggagcctccacttcctgcccaaactggaa
gtcctcgacctggcaggaaaccagctgaaggccctgaccaatggcagcctgcctgctggc
acccggctccggaggctggatgtcagctgcaacagcatcagcttcgtggcccccggcttc
ttttccaaggccaaggagctgcgagagctcaaccttagcgccaacgccctcaagacagtg
gaccactcctggtttgggcccctggcgagtgccctgcaaatactagatgtaagcgccaac
cctctgcactgcgcctgtggggcggcctttatggacttcctgctggaggtgcaggctgcc
gtgcccggtctgcccagccgggtgaagtgtggcagtccgggccagctccagggcctcagc
atctttgcacaggacctgcgcctctgcctggatgaggccctctcctgggactgtttcgcc
ctctcgctgctggctgtggctctgggcctgggtgtgcccatgctgcatcacctctgtggc
tgggacctctggtactgcttccacctgtgcctggcctggcttccctggcgggggcggcaa
agtgggcgagatgaggatgccctgccctacgatgccttcgtggtcttcgacaaaacgcag
agcgcagtggcagactgggtgtacaacgagcttcgggggcagctggaggagtgccgtggg
cgctgggcactccgcctgtgcctggaggaacgcgactggctgcctggcaaaaccctcttt
gagaacctgtgggcctcggtctatggcagccgcaagacgctgtttgtgctggcccacacg
gaccgggtcagtggtctcttgcgcgccagcttcctgctggcccagcagcgcctgctggag
gaccgcaaggacgtcgtggtgctggtgatcctgagccctgacggccgccgctcccgctac
gtgcggctgcgccagcgcctctgccgccagagtgtcctcctctggccccaccagcccagt
ggtcagcgcagcttctgggcccagctgggcatggccctgaccagggacaaccaccacttc
tataaccggaacttctgccagggacccacggccgaatag

DBGET integrated database retrieval system