KEGG   Homo sapiens (human): 5411Help
Entry
5411              CDS       T01001                                 

Gene name
PNN, DRS, DRSP, SDK3, memA
Definition
(RefSeq) pinin, desmosome associated protein
  KO
K13114  
pinin
Organism
hsa  Homo sapiens (human)
Pathway
RNA transport
mRNA surveillance pathway
Module
Exon junction complex (EJC)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    5411 (PNN)
   03015 mRNA surveillance pathway
    5411 (PNN)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    EJC complex
     5411 (PNN)
Spliceosome [BR:hsa03041]
 Complex C
  Other components
   EJC/TREX
    5411 (PNN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
14q21.1
AA seq 717 aa AA seqDB search
MAVAVRTLQEQLEKAKESLKNVDENIRKLTGRDPNDVRPIQARLLALSGPGGGRGRGSLL
LRRGFSDSGGGPPAKQRDLEGAVSRLGGERRTRRESRQESDPEDDDVKKPALQSSVVATS
KERTRRDLIQDQNMDEKGKQRNRRIFGLLMGTLQKFKQESTVATERQKRRQEIEQKLEVQ
AEEERKQVENERRELFEERRAKQTELRLLEQKVELAQLQEEWNEHNAKIIKYIRTKTKPH
LFYIPGRMCPATQKLIEESQRKMNALFEGRRIEFAEQINKMEARPRRQSMKEKEHQVVRN
EEQKAEQEEGKVAQREEELEETGNQHNDVEIEEAGEEEEKEIAIVHSDAEKEQEEEEQKQ
EMEVKMEEETEVRESEKQQDSQPEEVMDVLEMVENVKHVIADQEVMETNRVESVEPSENE
ASKELEPEMEFEIEPDKECKSLSPGKENVSALDMEKESEEKEEKESEPQPEPVAQPQPQS
QPQLQLQSQSQPVLQSQPPSQPEDLSLAVLQPTPQVTQEQGHLLPERKDFPVESVKLTEV
PVEPVLTVHPESKSKTKTRSRSRGRARNKTSKSRSRSSSSSSSSSSSTSSSSGSSSSSGS
SSSRSSSSSSSSTSGSSSRDSSSSTSSSSESRSRSRGRGHNRDRKHRRSVDRKRRDTSGL
ERSHKSSKGGSSRDTKGSKDKNSRSDRKRSISESSRSGKRSSRSERDRKSDRKDKRR
NT seq 2154 nt NT seq  +upstreamnt  +downstreamnt
atggcggtcgccgtgagaactttgcaggaacagctggaaaaggccaaagagagtcttaag
aacgtggatgagaacattcgcaagctcaccgggcgggatccgaatgacgtgaggcccatc
caagccagattgctggccctttctggtcctggtggaggtagaggacgtggtagtttatta
ctgaggcgtggattctcagatagtggaggaggacccccagccaaacagagagaccttgaa
ggggcagtcagtaggctgggcggggagcgtcggaccagaagagaatcacgccaggaaagc
gacccggaggatgatgatgttaaaaagccagcattgcagtcttcagttgtagctacctcc
aaagagcgcacacgtagagaccttatccaggatcaaaatatggatgaaaagggaaagcaa
aggaaccggcgaatatttggcttgttgatgggtacccttcaaaaatttaaacaagaatcc
actgttgctactgaaaggcaaaagcggcgccaggaaattgaacaaaaacttgaagttcag
gcagaagaagagagaaagcaggttgaaaatgaaaggagagaactgtttgaagagaggcgt
gctaaacagacagaactgcggcttttggaacagaaagttgagcttgcgcagctgcaagaa
gaatggaatgaacataatgccaaaataattaaatatataagaactaagacaaagccccat
ttgttttatattcctggaagaatgtgtccagctacccaaaaactaatagaagagtcacag
agaaaaatgaacgctttatttgaaggtagacgcatcgaatttgcagaacaaataaataaa
atggaggctaggcctagaagacaatcaatgaaggaaaaagagcatcaggtggtgcgtaat
gaagaacagaaggcggaacaagaagagggtaaggtggctcagcgagaggaagagttggag
gagacaggtaatcagcacaatgatgtagaaatagaggaagcaggagaggaagaggaaaag
gaaatagcgattgttcatagtgatgcagagaaagaacaggaggaggaagaacaaaaacag
gaaatggaggttaagatggaggaggaaactgaggtaagggaaagtgagaagcagcaggat
agtcagcctgaagaagttatggatgtgctagagatggttgagaatgtcaaacatgtaatt
gctgaccaggaggtaatggaaactaatcgagttgaaagtgtagaaccttcagaaaatgaa
gctagcaaagaattggaaccagaaatggaatttgaaattgagccagataaagaatgtaaa
tccctttctcctgggaaagagaatgtcagtgctttagacatggaaaaggagtctgaggaa
aaagaagaaaaagaatctgagccccaacctgagcctgtggctcaacctcagcctcagtct
cagccccagcttcagcttcaatcccagtcccaaccagtactccagtcccagcctccctct
cagcctgaggatttgtcattagctgttttacagccaacaccccaagttactcaggagcaa
gggcatttactacctgagaggaaggattttcctgtagagtctgtaaaactcactgaggta
ccagtagagccagtcttgacagtacatccagagagcaagagcaaaaccaaaactaggagc
agaagtagaggtcgagctagaaataaaacaagcaagagtagaagtcgaagcagtagcagt
agcagttctagtagcagttcaaccagtagcagcagtggaagtagttccagcagtggaagt
agtagcagtcgcagtagttccagtagcagctccagtacaagtggcagcagcagcagagat
agtagcagtagcactagtagtagtagtgagagtagaagtcggagtaggggccggggacat
aatagagatagaaagcacagaaggagcgtggatcggaagagaagggatacttcaggacta
gaaagaagtcacaaatcttcaaaaggtggtagtagtagagatacaaaaggatcaaaggat
aagaattcccggtccgacagaaagaggtctatatcagagagtagtcgatcaggcaaaaga
tcttcaagaagtgaaagagaccgaaaatcagacaggaaagacaaaaggcgttaa

DBGET integrated database retrieval system