KEGG   Homo sapiens (human): 5413Help
Entry
5413              CDS       T01001                                 

Gene name
SEPT5, CDCREL, CDCREL-1, CDCREL1, H5, HCDCREL-1, PNUTL1
Definition
(RefSeq) septin 5
  KO
K04557  
septin 5
Organism
hsa  Homo sapiens (human)
Pathway
Parkinson's disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Neurodegenerative diseases
   05012 Parkinson's disease
    5413 (SEPT5)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Septins
    5413 (SEPT5)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septins
    Group 2
     5413 (SEPT5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
Q99719(Tbio)
UniProt: 
Position
22q11.21
AA seq 369 aa AA seqDB search
MSTGLRYKSKLATPEDKQDIDKQYVGFATLPNQVHRKSVKKGFDFTLMVAGESGLGKSTL
VHSLFLTDLYKDRKLLSAEERISQTVEILKHTVDIEEKGVKLKLTIVDTPGFGDAVNNTE
CWKPITDYVDQQFEQYFRDESGLNRKNIQDNRVHCCLYFISPFGHGLRPVDVGFMKALHE
KVNIVPLIAKADCLVPSEIRKLKERIREEIDKFGIHVYQFPECDSDEDEDFKQQDRELKE
SAPFAVIGSNTVVEAKGQRVRGRLYPWGIVEVENQAHCDFVKLRNMLIRTHMHDLKDVTC
DVHYENYRAHCIQQMTSKLTQDSRMESPIPILPLPTPDAETEKLIRMKDEELRRMQEMLQ
RMKQQMQDQ
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgagcacaggcctgcggtacaagagcaagctggcgaccccagaggacaagcaggacatt
gacaagcagtacgtgggcttcgccacactgcccaaccaggtgcaccgcaagtcggtgaag
aaaggctttgacttcacactcatggtggctggtgagtcaggcctggggaagtccacactg
gtccacagcctcttcctgacagacttgtacaaggaccggaagctgctcagtgctgaggag
cgcatcagccagacggtagagattctaaaacacacggtggacattgaggagaagggagtc
aagctgaagctcaccatcgtggacacgccgggattcggggacgctgtcaacaacaccgag
tgctggaagcccatcaccgactatgtggaccagcagtttgagcagtacttccgtgatgag
agcggcctcaaccgaaagaacatccaagacaaccgagtgcactgctgcctatacttcatc
tcccccttcgggcatgggctgcggccagtggatgtgggtttcatgaaggcattgcatgag
aaggtcaacatcgtgcctctcatcgccaaagctgactgtcttgtccccagtgagatccgg
aagctgaaggagcggatccgggaggagattgacaagtttgggatccatgtataccagttc
cctgagtgtgactcggacgaggatgaggacttcaagcagcaggaccgggaactgaaggag
agcgcgcccttcgccgttataggcagcaacacggtggtggaggccaaggggcagcgggtc
cggggccgactgtacccctgggggatcgtggaggtggagaaccaggcgcattgcgacttc
gtgaagctgcgcaacatgctcatccgcacgcatatgcacgacctcaaggacgtgacgtgc
gacgtgcactacgagaactaccgcgcgcactgcatccagcagatgaccagcaaactgacc
caggacagccgcatggagagccccatcccgatcctgccgctgcccaccccggacgccgag
actgagaagcttatcaggatgaaggatgaggaactgaggcgcatgcaggagatgctgcag
aggatgaagcagcagatgcaggaccagtga

DBGET integrated database retrieval system