KEGG   Homo sapiens (human): 54187Help
Entry
54187             CDS       T01001                                 

Gene name
NANS, SAS
Definition
N-acetylneuraminic acid synthase (EC:2.5.1.56 2.5.1.57)
Orthology
K05304  
sialic acid synthase [EC:2.5.1.56 2.5.1.57]
Organism
hsa  Homo sapiens (human)
Pathway
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:hsa00520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
9p24.1-p23
AA seq 359 aa AA seqDB search
MPLELELCPGRWVGGQHPCFIIAEIGQNHQGDLDVAKRMIRMAKECGADCAKFQKSELEF
KFNRKALERPYTSKHSWGKTYGEHKRHLEFSHDQYRELQRYAEEVGIFFTASGMDEMAVE
FLHELNVPFFKVGSGDTNNFPYLEKTAKKGRPMVISSGMQSMDTMKQVYQIVKPLNPNFC
FLQCTSAYPLQPEDVNLRVISEYQKLFPDIPIGYSGHETGIAISVAAVALGAKVLERHIT
LDKTWKGSDHSASLEPGELAELVRSVRLVERALGSPTKQLLPCEMACNEKLGKSVVAKVK
IPEGTILTMDMLTVKVGEPKGYPPEDIFNLVGKKVLVTVEEDDTIMEELVDNHGKKIKS
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgccgctggagctggagctgtgtcccgggcgctgggtgggcgggcaacacccgtgcttc
atcattgccgagatcggccagaaccaccagggcgacctggacgtagccaagcgcatgatc
cgcatggccaaggagtgtggggctgattgtgctaagttccagaagagtgagctagaattc
aagtttaatcggaaagccttggagaggccatacacctcgaagcattcctgggggaagacg
tacggggagcacaaacgacatctggagttcagccatgaccagtacagggagctgcagagg
tacgccgaggaggttgggatcttcttcactgcctctggcatggatgagatggcagttgaa
ttcctgcatgaactgaatgttccatttttcaaagttggatctggagacactaataatttt
ccttatctggaaaagacagccaaaaaaggtcgcccaatggtgatctccagtgggatgcag
tcaatggacaccatgaagcaagtttatcagatcgtgaagcccctcaaccccaacttctgc
ttcttgcagtgtaccagcgcatacccgctccagcctgaggacgtcaacctgcgggtcatc
tcggaatatcagaagctctttcctgacattcccatagggtattctgggcatgaaacaggc
atagcgatatctgtggccgcagtggctctgggggccaaggtgttggaacgtcacataact
ttggacaagacctggaaggggagtgaccactcggcctcgctggagcctggagaactggcc
gagctggtgcggtcagtgcgtcttgtggagcgtgccctgggctccccaaccaagcagctg
ctgccctgtgagatggcctgcaatgagaagctgggcaagtctgtggtggccaaagtgaaa
attccggaaggcaccattctaacaatggacatgctcaccgtgaaggtgggtgagcccaaa
ggctatcctcctgaagacatctttaatctagtgggcaagaaggtcctggtcactgttgaa
gaggatgacaccatcatggaagaattggtagataatcatggcaaaaaaatcaagtcttaa

DBGET integrated database retrieval system