KEGG   Homo sapiens (human): 54207Help
Entry
54207             CDS       T01001                                 

Gene name
KCNK10, K2p10.1, PPP1R97, TREK-2, TREK2
Definition
(RefSeq) potassium two pore domain channel subfamily K member 10
  KO
K04920  
potassium channel subfamily K member 10
Organism
hsa  Homo sapiens (human)
Pathway
Gastric acid secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Digestive system
   04971 Gastric acid secretion
    54207 (KCNK10)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     54207 (KCNK10)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  K+ channel, KCNK, K2px.x
   54207 (KCNK10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
14q31.3
AA seq 538 aa AA seqDB search
MFFLYTDFFLSLVAVPAAAPVCQPKSATNGQPPAPAPTPTPRLSISSRATVVARMEGTSQ
GGLQTVMKWKTVVAIFVVVVVYLVTGGLVFRALEQPFESSQKNTIALEKAEFLRDHVCVS
PQELETLIQHALDADNAGVSPIGNSSNNSSHWDLGSAFFFAGTVITTIGYGNIAPSTEGG
KIFCILYAIFGIPLFGFLLAGIGDQLGTIFGKSIARVEKVFRKKQVSQTKIRVISTILFI
LAGCIVFVTIPAVIFKYIEGWTALESIYFVVVTLTTVGFGDFVAGGNAGINYREWYKPLV
WFWILVGLAYFAAVLSMIGDWLRVLSKKTKEEVGEIKAHAAEWKANVTAEFRETRRRLSV
EIHDKLQRAATIRSMERRRLGLDQRAHSLDMLSPEKRSVFAALDTGRFKASSQESINNRP
NNLRLKGPEQLNKHGQGASEDNIINKFGSTSRLTKRKNKDLKKTLPEDVQKIYKTFRNYS
LDEEKKEEETEKMCNSDNSSTAMLTDCIQQHAELENGMIPTDTKDREPENNSLLEDRN
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atgttttttctctacacagacttctttctttccttggtggccgttcccgcagcagcaccg
gtgtgccagcccaagagcgccactaacgggcaacccccggctccggctccgactccaact
ccgcgcctgtccatttcctcccgagccacagtggtagccaggatggaaggcacctcccaa
gggggcttgcagaccgtcatgaagtggaagacggtggttgccatctttgtggttgtggtg
gtctaccttgtcactggcggtcttgtcttccgggcattggagcagccctttgagagcagc
cagaagaataccatcgccttggagaaggcggaattcctgcgggatcatgtctgtgtgagc
ccccaggagctggagacgttgatccagcatgctcttgatgctgacaatgcgggagtcagt
ccaataggaaactcttccaacaacagcagccactgggacctcggcagtgcctttttcttt
gctggaactgtcattacgaccatagggtatgggaatattgctccgagcactgaaggaggc
aaaatcttttgtattttatatgccatctttggaattccactctttggtttcttattggct
ggaattggagaccaacttggaaccatctttgggaaaagcattgcaagagtggagaaggtc
tttcgaaaaaagcaagtgagtcagaccaagatccgggtcatctcaaccatcctgttcatc
ttggccggctgcattgtgtttgtgacgatccctgctgtcatctttaagtacatcgagggc
tggacggccttggagtccatttactttgtggtggtcactctgaccacggtgggctttggt
gattttgtggcagggggaaacgctggcatcaattatcgggagtggtataagcccctagtg
tggttttggatccttgttggccttgcctactttgcagctgtcctcagtatgatcggagat
tggctacgggttctgtccaaaaagacaaaagaagaggtgggtgaaatcaaggcccatgcg
gcagagtggaaggccaatgtcacggctgagttccgggagacacggcgaaggctcagcgtg
gagatccacgataagctgcagcgggcggccaccatccgcagcatggagcgccggcggctg
ggcctggaccagcgggcccactcactggacatgctgtcccccgagaagcgctctgtcttt
gctgccctggacaccggccgcttcaaggcctcatcccaggagagcatcaacaaccggccc
aacaacctgcgcctgaaggggccggagcagctgaacaagcatgggcagggtgcgtccgag
gacaacatcatcaacaagttcgggtccacctccagactcaccaagaggaaaaacaaggac
ctcaaaaagaccttgcccgaggacgttcagaaaatctacaagaccttccggaattactcc
ctggacgaggagaagaaagaggaggagacggaaaagatgtgtaactcagacaactccagc
acagccatgctgacggactgtatccagcagcacgctgagttggagaacggaatgataccc
acggacaccaaagaccgggagccggagaacaactcattacttgaagacagaaactaa

DBGET integrated database retrieval system