KEGG   Homo sapiens (human): 5424Help
Entry
5424              CDS       T01001                                 

Gene name
POLD1, CDC2, CRCS10, MDPL, POLD
Definition
(RefSeq) polymerase (DNA) delta 1, catalytic subunit (EC:2.7.7.7)
  KO
K02327  
DNA polymerase delta subunit 1 [EC:2.7.7.7]
Organism
hsa  Homo sapiens (human)
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Homologous recombination
HTLV-I infection
Module
DNA polymerase delta complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    5424 (POLD1)
   00240 Pyrimidine metabolism
    5424 (POLD1)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    5424 (POLD1)
   03410 Base excision repair
    5424 (POLD1)
   03420 Nucleotide excision repair
    5424 (POLD1)
   03430 Mismatch repair
    5424 (POLD1)
   03440 Homologous recombination
    5424 (POLD1)
 Human Diseases
  Infectious diseases
   05166 HTLV-I infection
    5424 (POLD1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     5424 (POLD1)
DNA replication proteins [BR:hsa03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   DNA polymerase delta complex
    5424 (POLD1)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      5424 (POLD1)
   MMR (mismatch exicision repair)
    DNA polymerase delta complex
     5424 (POLD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19q13.3
AA seq 1107 aa AA seqDB search
MDGKRRPGPGPGVPPKRARGGLWDDDDAPRPSQFEEDLALMEEMEAEHRLQEQEEEELQS
VLEGVADGQVPPSAIDPRWLRPTPPALDPQTEPLIFQQLEIDHYVGPAQPVPGGPPPSRG
SVPVLRAFGVTDEGFSVCCHIHGFAPYFYTPAPPGFGPEHMGDLQRELNLAISRDSRGGR
ELTGPAVLAVELCSRESMFGYHGHGPSPFLRITVALPRLVAPARRLLEQGIRVAGLGTPS
FAPYEANVDFEIRFMVDTDIVGCNWLELPAGKYALRLKEKATQCQLEADVLWSDVVSHPP
EGPWQRIAPLRVLSFDIECAGRKGIFPEPERDPVIQICSLGLRWGEPEPFLRLALTLRPC
APILGAKVQSYEKEEDLLQAWSTFIRIMDPDVITGYNIQNFDLPYLISRAQTLKVQTFPF
LGRVAGLCSNIRDSSFQSKQTGRRDTKVVSMVGRVQMDMLQVLLREYKLRSYTLNAVSFH
FLGEQKEDVQHSIITDLQNGNDQTRRRLAVYCLKDAYLPLRLLERLMVLVNAVEMARVTG
VPLSYLLSRGQQVKVVSQLLRQAMHEGLLMPVVKSEGGEDYTGATVIEPLKGYYDVPIAT
LDFSSLYPSIMMAHNLCYTTLLRPGTAQKLGLTEDQFIRTPTGDEFVKTSVRKGLLPQIL
ENLLSARKRAKAELAKETDPLRRQVLDGRQLALKVSANSVYGFTGAQVGKLPCLEISQSV
TGFGRQMIEKTKQLVESKYTVENGYSTSAKVVYGDTDSVMCRFGVSSVAEAMALGREAAD
WVSGHFPSPIRLEFEKVYFPYLLISKKRYAGLLFSSRPDAHDRMDCKGLEAVRRDNCPLV
ANLVTASLRRLLIDRDPEGAVAHAQDVISDLLCNRIDISQLVITKELTRAASDYAGKQAH
VELAERMRKRDPGSAPSLGDRVPYVIISAAKGVAAYMKSEDPLFVLEHSLPIDTQYYLEQ
QLAKPLLRIFEPILGEGRAEAVLLRGDHTRCKTVLTGKVGGLLAFAKRRNCCIGCRTVLS
HQGAVCEFCQPRESELYQKEVSHLNALEERFSRLWTQCQRCQGSLHEDVICTSRDCPIFY
MRKKVRKDLEDQEQLLRRFGPPGPEAW
NT seq 3324 nt NT seq  +upstreamnt  +downstreamnt
atggatggcaagcggcggccaggcccagggcccggggtgcccccaaagcgggcccgtggg
ggcctctgggatgatgatgatgcacctcggccatcccaattcgaggaggacctggcactg
atggaggagatggaggcagaacacaggctgcaggagcaggaggaggaggagctgcagtca
gtcctggagggggttgcagacgggcaggtcccaccatcagccatagatcctcgctggctt
cggcccacaccaccagcgctggacccccagacagagcccctcatcttccaacagttggag
attgaccattatgtgggcccagcgcagcctgtgcctggggggcccccaccatcccgcggc
tccgtgcctgtgctccgcgccttcggggtcaccgatgaggggttctctgtctgctgccac
atccacggcttcgctccctacttctacaccccagcgccccctggtttcgggcccgagcac
atgggtgacctgcaacgggagctgaacttggccatcagccgggacagtcgcggggggagg
gagctgactgggccggccgtgctggctgtggaactgtgctcccgagagagcatgtttggg
taccacgggcacggcccctccccgttcctgcgcatcaccgtggcgctgccgcgcctcgtg
gccccggcccgccgtctcctggaacagggcatccgtgtggcaggcctgggcacgcccagc
ttcgcgccctacgaggccaacgtcgactttgagatccggttcatggtggacacggacatc
gtcggctgcaactggctggagctcccagctgggaaatacgccctgaggctgaaggagaag
gctacgcagtgccagctggaggcggacgtgctgtggtctgacgtggtcagtcacccaccg
gaagggccatggcagcgcattgcgcccttgcgcgtgctcagcttcgatatcgagtgcgcc
ggccgcaaaggcatcttccctgagcctgagcgggaccctgtcatccagatctgctcgctg
ggcctgcgctggggggagccggagcccttcctacgcctggcgctcaccctgcggccctgt
gcccccatcctgggtgccaaggtgcagagctacgagaaggaggaggacctgctgcaggcc
tggtccaccttcatccgtatcatggaccccgacgtgatcaccggttacaacatccagaac
ttcgaccttccgtacctcatctctcgggcccagaccctcaaggtacaaacattccctttc
ctgggccgtgtggccggcctttgctccaacatccgggactcttcattccagtccaagcag
acgggccggcgggacaccaaggttgtcagcatggtgggccgcgtgcagatggacatgctg
caggtgctgctgcgggagtacaagctccgctcctacacgctcaatgccgtgagcttccac
ttcctgggcgagcagaaggaggacgtgcagcacagcatcatcaccgacctgcagaatggg
aacgaccagacccgccgccgcctggctgtgtactgcctgaaggatgcctacctgccactg
cggctgctggagcggctcatggtgctggtgaacgccgtggagatggcgagggtcactggc
gtgcccctcagctacctgctcagtcgtggccagcaggtcaaggtcgtatcccagctgttg
cggcaggccatgcacgaggggctgctgatgcccgtggtgaagtcagagggcggcgaggac
tacacgggagccactgtcatcgagcccctcaaagggtactacgacgtccccatcgccacc
ctggacttctcctcgctgtacccgtccatcatgatggcccacaacctgtgttacaccacg
ctccttcggcccgggactgcacagaaactgggcctgactgaggatcagttcatcaggacc
cccaccggggacgagtttgtgaagacctcagtgcggaaggggctgctgccccagatcctg
gagaacctgctcagtgcccggaagagggccaaggccgagctggccaaggagacagacccc
ctccggcgccaggtcctggatggacggcagctggcgctgaaggtgagcgccaactccgta
tacggcttcactggcgcccaggtgggcaagttgccgtgcctggagatctcacagagcgtc
acggggttcggacgtcagatgatcgagaaaaccaagcagctggtggagtctaagtacaca
gtggagaatggctacagcaccagtgccaaggtggtgtatggtgacactgactccgtcatg
tgccgattcggcgtgtcctcggtggctgaggcgatggccctggggcgggaggccgcggac
tgggtgtcaggtcacttcccgtcgcccatccggctggagtttgagaaggtctacttccca
tacctgcttatcagcaagaagcgctacgcgggcctgctcttctcctcccggcccgacgcc
cacgaccgcatggactgcaagggcctggaggccgtgcgcagggacaactgccccctcgtg
gccaacctggtcactgcctcactgcgccgcctgctcatcgaccgagaccctgagggcgcg
gtggctcacgcacaggacgtcatctcggacctgctgtgcaaccgcatcgatatctcccag
ctggtcatcaccaaggagctgacccgcgcggcctccgactatgccggcaagcaggcccac
gtggagctggccgagaggatgaggaagcgggaccccgggagtgcgcccagcctgggcgac
cgcgtcccctacgtgatcatcagtgccgccaagggtgtggccgcctacatgaagtcggag
gacccgctgttcgtgctggagcacagcctgcccattgacacgcagtactacctggagcag
cagctggccaagcccctcctgcgcatcttcgagcccatcctgggcgagggccgtgccgag
gctgtgctactgcggggggaccacacgcgctgcaagacggtgctcacgggcaaggtgggc
ggcctcctggccttcgccaaacgccgcaactgctgcattggctgccgcacagtgctcagc
caccagggagccgtgtgtgagttctgccagccccgggagtctgagctgtatcagaaggag
gtatcccatctgaatgccctggaggagcgcttctcgcgcctctggacgcagtgccagcgc
tgccagggcagcctgcacgaggacgtcatctgcaccagccgggactgccccatcttctac
atgcgcaagaaggtgcggaaggacctggaagaccaggagcagctcctgcggcgcttcgga
ccccctggacctgaggcctggtga

DBGET integrated database retrieval system