KEGG   Homo sapiens (human): 5427Help
Entry
5427              CDS       T01001                                 

Gene name
POLE2, DPE2
Definition
(RefSeq) DNA polymerase epsilon 2, accessory subunit
  KO
K02325  
DNA polymerase epsilon subunit 2 [EC:2.7.7.7]
Organism
hsa  Homo sapiens (human)
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Base excision repair
Nucleotide excision repair
HTLV-I infection
Module
DNA polymerase epsilon complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    5427 (POLE2)
   00240 Pyrimidine metabolism
    5427 (POLE2)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    5427 (POLE2)
   03410 Base excision repair
    5427 (POLE2)
   03420 Nucleotide excision repair
    5427 (POLE2)
 Human Diseases
  Infectious diseases
   05166 HTLV-I infection
    5427 (POLE2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     5427 (POLE2)
DNA replication proteins [BR:hsa03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   DNA polymerase epsilon complex
    5427 (POLE2)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase epsilon complex
      5427 (POLE2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P56282(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
14q21.3
AA seq 527 aa AA seqDB search
MAPERLRSRALSAFKLRGLLLRGEAIKYLTEALQSISELELEDKLEKIINAVEKQPLSSN
MIERSVVEAAVQECSQSVDETIEHVFNIIGAFDIPRFVYNSERKKFLPLLMTNHPAPNLF
GTPRDKAEMFRERYTILHQRTHRHELFTPPVIGSHPDESGSKFQLKTIETLLGSTTKIGD
AIVLGMITQLKEGKFFLEDPTGTVQLDLSKAQFHSGLYTEACFVLAEGWFEDQVFHVNAF
GFPPTEPSSTTRAYYGNINFFGGPSNTSVKTSAKLKQLEEENKDAMFVFLSDVWLDQVEV
LEKLRIMFAGYSPAPPTCFILCGNFSSAPYGKNQVQALKDSLKTLADIICEYPDIHQSSR
FVFVPGPEDPGFGSILPRPPLAESITNEFRQRVPFSVFTTNPCRIQYCTQEITVFREDLV
NKMCRNCVRFPSSNLAIPNHFVKTILSQGHLTPLPLYVCPVYWAYDYALRVYPVPDLLVI
ADKYDPFTTTNTECLCINPGSFPRSGFSFKVFYPSNKTVEDSKLQGF
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atggcgccggagcggctgcggagccgggcgctctccgccttcaagttgcggggcttgctg
ctccgtggtgaagctattaagtacctcacagaagctcttcagtctatcagtgaattagag
cttgaagataaactggaaaagataattaatgcagttgagaagcaacccttgtcatcaaac
atgattgaacgatctgtggtggaagcagcagtccaggaatgcagtcagtctgttgatgaa
actatagagcacgttttcaatatcataggagcatttgatattccacgctttgtgtacaat
tcagaaagaaaaaaatttcttcctctgttaatgaccaaccaccctgcaccaaatttattt
ggaacaccaagagataaagcagagatgtttcgtgagcgatataccattttgcaccagagg
acccacaggcatgaattatttactcctccggtgataggttctcaccctgatgaaagcgga
agcaaattccagcttaaaacaatagaaaccttattgggtagtacaaccaaaatcggagat
gcgattgttcttggaatgataacgcagttaaaagagggaaaattttttctggaagatcct
actggaacagtccaactagaccttagtaaagctcagttccatagtggtttatacacagag
gcatgctttgtcttagcagaaggttggtttgaagatcaagtgtttcatgtcaatgccttt
ggatttccacccactgagccctctagtactactagggcatactatggaaatattaatttt
tttggaggtccttctaatacatctgtgaagacttctgcaaaactaaaacagctagaagag
gagaataaagatgctatgtttgtgtttttatctgatgtttggttggaccaggtggaagta
ttggaaaaacttcgcataatgtttgctggttattcaccagcacctccaacctgctttatt
ctgtgtggtaatttttcatctgcaccatatggaaaaaatcaagttcaagctttgaaagat
tccctaaaaactttggcagatataatatgtgaatacccagatattcaccaaagtagtcgt
tttgtgtttgtacctggtccagaggatcctggatttggttccatcttaccaaggccacca
cttgctgaaagcatcactaatgaattcagacaaagggtaccattttcagtttttactact
aatccttgcagaattcagtactgtacacaggaaattactgtcttccgtgaagacttagta
aataaaatgtgcagaaactgcgtccgttttcctagcagcaatttggctattcctaatcac
tttgtaaagactatcttatcccaaggacatctgactcccctacctctttatgtctgccca
gtgtattgggcatatgactatgctttgagagtgtatcctgtgcccgatctacttgtcatt
gcagacaaatatgatcctttcactacgacaaataccgaatgcctctgcataaaccctggc
tcttttccaagaagtggattttcattcaaagttttttatccttctaataagacagtagaa
gatagcaaacttcaaggcttttga

DBGET integrated database retrieval system