KEGG   Homo sapiens (human): 54331Help
Entry
54331             CDS       T01001                                 

Gene name
GNG2
Definition
guanine nucleotide binding protein (G protein), gamma 2
Orthology
K07826  
guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2
Organism
hsa  Homo sapiens (human)
Pathway
Ras signaling pathway
Chemokine signaling pathway
PI3K-Akt signaling pathway
Circadian entrainment
Retrograde endocannabinoid signaling
Glutamatergic synapse
Cholinergic synapse
Serotonergic synapse
GABAergic synapse
Dopaminergic synapse
Morphine addiction
Alcoholism
Pathways in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    54331 (GNG2)
   04151 PI3K-Akt signaling pathway
    54331 (GNG2)
 Organismal Systems
  Immune system
   04062 Chemokine signaling pathway
    54331 (GNG2)
  Nervous system
   04724 Glutamatergic synapse
    54331 (GNG2)
   04727 GABAergic synapse
    54331 (GNG2)
   04725 Cholinergic synapse
    54331 (GNG2)
   04728 Dopaminergic synapse
    54331 (GNG2)
   04726 Serotonergic synapse
    54331 (GNG2)
   04723 Retrograde endocannabinoid signaling
    54331 (GNG2)
  Environmental adaptation
   04713 Circadian entrainment
    54331 (GNG2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    54331 (GNG2)
  Substance dependence
   05032 Morphine addiction
    54331 (GNG2)
   05034 Alcoholism
    54331 (GNG2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   54331 (GNG2)
GTP-binding proteins [BR:hsa04031]
 Heterotrimeric G-proteins
  Gamma Subunits
   Gamma [OT]
    54331 (GNG2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
14q21
AA seq 71 aa AA seqDB search
MASNNTASIAQARKLVEQLKMEANIDRIKVSKAAADLMAYCEAHAKEDPLLTPVPASENP
FREKKFFCAIL
NT seq 216 nt NT seq  +upstreamnt  +downstreamnt
atggccagcaacaacaccgccagcatagcacaagccaggaagctggtagagcagcttaag
atggaagccaatatcgacaggataaaggtgtccaaggcagctgcagatttgatggcctac
tgtgaagcacatgccaaggaagaccccctcctgacccctgttccggcttcagaaaacccg
tttagggagaagaagtttttctgtgccatcctttaa

DBGET integrated database retrieval system