KEGG   Homo sapiens (human): 54413Help
Entry
54413             CDS       T01001                                 

Gene name
NLGN3, HNL3
Definition
(RefSeq) neuroligin 3
  KO
K07378  
neuroligin
Organism
hsa  Homo sapiens (human)
Pathway
Cell adhesion molecules (CAMs)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    54413 (NLGN3)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Others
    54413 (NLGN3)
Cell adhesion molecules and their ligands [BR:hsa04516]
 7. Others
  NRXN; neurexin [KO:K07377]
   54413 (NLGN3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q9NZ94(Tbio)
UniProt: 
Position
Xq13.1
AA seq 848 aa AA seqDB search
MWLRLGPPSLSLSPKPTVGRSLCLTLWFLSLALRASTQAPAPTVNTHFGKLRGARVPLPS
EILGPVDQYLGVPYAAPPIGEKRFLPPEPPPSWSGIRNATHFPPVCPQNIHTAVPEVMLP
VWFTANLDIVATYIQEPNEDCLYLNVYVPTEDVKRISKECARKPNKKICRKGGSGAKKQG
EDLADNDGDEDEDIRDSGAKPVMVYIHGGSYMEGTGNMIDGSILASYGNVIVITLNYRVG
VLGFLSTGDQAAKGNYGLLDQIQALRWVSENIAFFGGDPRRITVFGSGIGASCVSLLTLS
HHSEGLFQRAIIQSGSALSSWAVNYQPVKYTSLLADKVGCNVLDTVDMVDCLRQKSAKEL
VEQDIQPARYHVAFGPVIDGDVIPDDPEILMEQGEFLNYDIMLGVNQGEGLKFVEGVVDP
EDGVSGTDFDYSVSNFVDNLYGYPEGKDTLRETIKFMYTDWADRDNPETRRKTLVALFTD
HQWVEPSVVTADLHARYGSPTYFYAFYHHCQSLMKPAWSDAAHGDEVPYVFGVPMVGPTD
LFPCNFSKNDVMLSAVVMTYWTNFAKTGDPNKPVPQDTKFIHTKANRFEEVAWSKYNPRD
QLYLHIGLKPRVRDHYRATKVAFWKHLVPHLYNLHDMFHYTSTTTKVPPPDTTHSSHITR
RPNGKTWSTKRPAISPAYSNENAQGSWNGDQDAGPLLVENPRDYSTELSVTIAVGASLLF
LNVLAFAALYYRKDKRRQEPLRQPSPQRGAGAPELGAAPEEELAALQLGPTHHECEAGPP
HDTLRLTALPDYTLTLRRSPDDIPLMTPNTITMIPNSLVGLQTLHPYNTFAAGFNSTGLP
HSHSTTRV
NT seq 2547 nt NT seq  +upstreamnt  +downstreamnt
atgtggctgcggcttggcccgccctcgctgtccctgagccccaagcccacggttggcagg
agcctgtgcctcaccctgtggttcctcagtttggcgctgagggccagtacccaggcccca
gcacccacagtcaacactcactttgggaagctaaggggtgcccgagtaccactgcccagt
gagatcctggggcctgtggaccaatacctgggggtgccctacgcagctcccccgatcggc
gagaaacgtttcctgccccctgaaccacccccatcctggtcgggcatccggaacgccaca
cactttcccccagtgtgcccccagaacatccacacagctgtgcccgaagtcatgctgccg
gtctggttcactgccaacttggatatcgtcgctacttacatccaggagcccaacgaagac
tgtctctacctgaacgtctatgtgccgacggaggatgtaaagcggatttccaaggaatgc
gcccgaaagcccaacaagaaaatttgtaggaaaggaggatccggcgctaagaaacagggc
gaggacttagcggataatgacggggatgaagatgaagacatccgggacagtggtgctaaa
cccgtcatggtctacatccacggaggctcttacatggaagggacaggcaacatgattgat
ggcagcatcctcgccagttatggcaatgtcatcgtcatcaccctcaactatcgggttgga
gtgctaggtttcctgagtactggagatcaggctgccaagggcaactatgggctccttgac
cagatccaggccctccgctgggtgagcgagaatattgccttcttcgggggagacccccgc
cggatcactgtctttggctcgggcattggtgcatcctgcgtcagcctcctcacgttgtca
catcactcagagggacttttccagagagccatcatccaaagtggctctgctctgtccagc
tgggctgtgaactaccaaccagtgaagtacaccagcctgctggcagacaaagtgggctgt
aatgtgctggacaccgtggatatggtggactgtcttcggcaaaagagtgccaaggagctg
gtagagcaggacatccagccagcccgctaccacgtggcctttggccctgtgattgatggt
gatgtcattcctgatgaccctgagatcctcatggagcagggcgagttcctcaactatgac
atcatgctaggtgtcaaccagggcgagggtctcaagtttgtggaaggggtggtggaccct
gaggatggtgtctctggcactgactttgactattccgtctccaattttgtggacaatctg
tatggctatcctgagggtaaggacaccctgcgagagaccatcaagttcatgtatacagac
tgggcagaccgtgacaaccctgagacccgccgtaaaacactggtggcactcttcactgac
caccagtgggtggagccctcagtggtgacagccgatctgcatgcccgctacggctcgcct
acctacttctacgccttctatcatcactgccagagcctcatgaagcctgcttggtcagat
gcagctcatggggatgaagtaccctatgtttttggggttcctatggtaggccccactgac
cttttcccctgcaacttctccaagaatgatgttatgctcagtgctgtcgtcatgacctat
tggaccaactttgccaagactggggatcccaacaagccggtcccccaggacaccaagttc
attcacaccaaggccaaccgctttgaggaagtggcctggtccaaatacaatccccgagac
cagctctaccttcacatcgggctgaaaccaagggtccgagatcattaccgggccactaag
gtggccttttggaaacatctggtgccccacctatacaacctgcatgacatgttccactat
acgtccaccaccaccaaagtgccgcctccggataccacccacagctcccacatcacccgc
aggcccaatggcaagacctggagcaccaagcggccagccatctcacctgcctacagcaac
gagaatgcccaggggtcctggaacggggaccaggatgcagggccactcctggtggagaac
cctcgtgactactccactgaattaagtgtcaccatcgccgtgggggcctccctcctgttc
cttaacgttctggccttcgctgccctctactaccgtaaggacaaacggcgccaggagccc
ctgcggcagcctagccctcagcggggagccggggccccggagttgggagctgctccagag
gaggagctggcagcattacaactgggccccacccaccacgagtgtgaggccggtcccccc
catgacacgctgcgcctcactgcattgcccgactacaccctgaccctgcggcgctccccg
gatgacatcccactcatgacccccaacaccatcactatgatccccaactccctggtaggg
ctgcagacattgcacccctataacacctttgccgcagggttcaacagtaccgggctgccc
cactcacactccactacccgggtatag

DBGET integrated database retrieval system