KEGG   Homo sapiens (human): 54429Help
Entry
54429             CDS       T01001                                 

Gene name
TAS2R5, T2R5
Definition
taste receptor, type 2, member 5
Orthology
K08474  
taste receptor type 2
Organism
hsa  Homo sapiens (human)
Pathway
Taste transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04742 Taste transduction
    54429 (TAS2R5)
G protein-coupled receptors [BR:hsa04030]
 Others
  Chemoreception
   Taste type 2
    54429 (TAS2R5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
7q31.3-q32
AA seq 299 aa AA seqDB search
MLSAGLGLLMLVAVVEFLIGLIGNGSLVVWSFREWIRKFNWSSYNLIILGLAGCRFLLQW
LIILDLSLFPLFQSSRWLRYLSIFWVLVSQASLWFATFLSVFYCKKITTFDRPAYLWLKQ
RAYNLSLWCLLGYFIINLLLTVQIGLTFYHPPQGNSSIRYPFESWQYLYAFQLNSGSYLP
LVVFLVSSGMLIVSLYTHHKKMKVHSAGRRDVRAKAHITALKSLGCFLLLHLVYIMASPF
SITSKTYPPDLTSVFIWETLMAAYPSLHSLILIMGIPRVKQTCQKILWKTVCARRCWGP
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgctgagcgctggcctaggactgctgatgctggtggcagtggttgaatttctcatcggt
ttaattggaaatggaagcctggtggtctggagttttagagaatggatcagaaaattcaac
tggtcctcatataacctcattatcctgggcctggctggctgccgatttctcctgcagtgg
ctgatcattttggacttaagcttgtttccacttttccagagcagccgttggcttcgctat
cttagtatcttctgggtcctggtaagccaggccagcttatggtttgccaccttcctcagt
gtcttctattgcaagaagatcacgaccttcgatcgcccggcctacttgtggctgaagcag
agggcctataacctgagtctctggtgccttctgggctactttataatcaatttgttactt
acagtccaaattggcttaacattctatcatcctccccaaggaaacagcagcattcggtat
ccctttgaaagctggcagtacctgtatgcatttcagctcaattcaggaagttatttgcct
ttagtggtgtttcttgtttcctctgggatgctgattgtctctttgtatacacaccacaag
aagatgaaggtccattcagctggtaggagggatgtccgggccaaggctcacatcactgcg
ctgaagtccttgggctgcttcctcttacttcacctggtttatatcatggccagccccttc
tccatcacctccaagacttatcctcctgatctcaccagtgtcttcatctgggagacactc
atggcagcctatccttctcttcattctctcatattgatcatggggattcctagggtgaag
cagacttgtcagaagatcctgtggaagacagtgtgtgctcggagatgctggggcccatga

DBGET integrated database retrieval system