KEGG   Homo sapiens (human): 54431Help
Entry
54431             CDS       T01001                                 

Gene name
DNAJC10, ERdj5, JPDI, MTHr, PDIA19
Definition
DnaJ (Hsp40) homolog, subfamily C, member 10
Orthology
K09530  
DnaJ homolog subfamily C member 10
Organism
hsa  Homo sapiens (human)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    54431 (DNAJC10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
2q32.1
AA seq 747 aa AA seqDB search
MGVWLNKDDYIRDLKRIILCFLIVYMAILVGTDQDFYSLLGVSKTASSREIRQAFKKLAL
KLHPDKNPNNPNAHGDFLKINRAYEVLKDEDLRKKYDKYGEKGLEDNQGGQYESWNYYRY
DFGIYDDDPEIITLERREFDAAVNSGELWFVNFYSPGCSHCHDLAPTWRDFAKEVDGLLR
IGAVNCGDDRMLCRMKGVNSYPSLFIFRSGMAPVKYHGDRSKESLVSFAMQHVRSTVTEL
WTGNFVNSIQTAFAAGIGWLITFCSKGGDCLTSQTRLRLSGMLFLNSLDAKEIYLEVIHN
LPDFELLSANTLEDRLAHHRWLLFFHFGKNENSNDPELKKLKTLLKNDHIQVGRFDCSSA
PDICSNLYVFQPSLAVFKGQGTKEYEIHHGKKILYDILAFAKESVNSHVTTLGPQNFPAN
DKEPWLVDFFAPWCPPCRALLPELRRASNLLYGQLKFGTLDCTVHEGLCNMYNIQAYPTT
VVFNQSNIHEYEGHHSAEQILEFIEDLMNPSVVSLTPTTFNELVTQRKHNEVWMVDFYSP
WCHPCQVLMPEWKRMARTLTGLINVGSIDCQQYHSFCAQENVQRYPEIRFFPPKSNKAYH
YHSYNGWNRDAYSLRIWGLGFLPQVSTDLTPQTFSEKVLQGKNHWVIDFYAPWCGPCQNF
APEFELLARMIKGKVKAGKVDCQAYAQTCQKAGIRAYPTVKFYFYERAKRNFQEEQINTR
DAKAIAALISEKLETLRNQGKRNKDEL
NT seq 2244 nt NT seq  +upstreamnt  +downstreamnt
atgggagtctggttaaataaagatgactatatcagagacttgaaaaggatcattctctgt
tttctgatagtgtatatggccattttagtgggcacagatcaggatttttacagtttactt
ggagtgtccaaaactgcaagcagtagagaaataagacaagctttcaagaaattggcattg
aagttacatcctgataaaaacccgaataacccaaatgcacatggcgattttttaaaaata
aatagagcatatgaagtactcaaagatgaagatctacggaaaaagtatgacaaatatgga
gaaaagggacttgaggataatcaaggtggccagtatgaaagctggaactattatcgttat
gattttggtatttatgatgatgatcctgaaatcataacattggaaagaagagaatttgat
gctgctgttaattctggagaactgtggtttgtaaatttttactccccaggctgttcacac
tgccatgatttagctcccacatggagagactttgctaaagaagtggatgggttacttcga
attggagctgttaactgtggtgatgatagaatgctttgccgaatgaaaggagtcaacagc
tatcccagcctcttcatttttcggtctggaatggccccagtgaaatatcatggagacaga
tcaaaggagagtttagtgagttttgcaatgcagcatgttagaagtacagtgacagaactt
tggacaggaaattttgtcaactccatacaaactgcttttgctgctggtattggctggctg
atcactttttgttcaaaaggaggagattgtttgacttcacagacacgactcaggcttagt
ggcatgttgtttctcaactcattggatgctaaagaaatatatttggaagtaatacataat
cttccagattttgaactactttcggcaaacacactagaggatcgtttggctcatcatcgg
tggctgttattttttcattttggaaaaaatgaaaattcaaatgatcctgagctgaaaaaa
ctaaaaactctacttaaaaatgatcatattcaagttggcaggtttgactgttcctctgca
ccagacatctgtagtaatctgtatgtttttcagccgtctctagcagtatttaaaggacaa
ggaaccaaagaatatgaaattcatcatggaaagaagattctatatgatatacttgccttt
gccaaagaaagtgtgaattctcatgttaccacgcttggacctcaaaattttcctgccaat
gacaaagaaccatggcttgttgatttctttgccccctggtgtccaccatgtcgagcttta
ctaccagagttacgaagagcatcaaatcttctttatggtcagcttaagtttggtacacta
gattgtacagttcatgagggactctgtaacatgtataacattcaggcttatccaacaaca
gtggtattcaaccagtccaacattcatgagtatgaaggacatcactctgctgaacaaatc
ttggagttcatagaggatcttatgaatccttcagtggtctcccttacacccaccaccttc
aacgaactagttacacaaagaaaacacaacgaagtctggatggttgatttctattctccg
tggtgtcatccttgccaagtcttaatgccagaatggaaaagaatggcccggacattaact
ggactgatcaacgtgggcagtatagattgccaacagtatcattctttttgtgcccaggaa
aacgttcaaagataccctgagataagattttttcccccaaaatcaaataaagcttatcat
tatcacagttacaatggttggaatagggatgcttattccctgagaatctggggtctagga
tttttacctcaagtatccacagatctaacacctcagactttcagtgaaaaagttctacaa
gggaaaaatcattgggtgattgatttctatgctccttggtgtggaccttgccagaatttt
gctccagaatttgagctcttggctaggatgattaaaggaaaagtgaaagctggaaaagta
gactgtcaggcttatgctcagacatgccagaaagctgggatcagggcctatccaactgtt
aaattttatttctacgaaagagcaaagagaaattttcaagaagagcagataaataccaga
gatgcaaaagcaatcgctgccttaataagtgaaaaattggaaactctccgaaatcaaggc
aagaggaataaggatgaactttga

DBGET integrated database retrieval system