KEGG   Homo sapiens (human): 54433Help
Entry
54433             CDS       T01001                                 

Gene name
GAR1, NOLA1
Definition
(RefSeq) GAR1 ribonucleoprotein
  KO
K11128  
H/ACA ribonucleoprotein complex subunit 1
Organism
hsa  Homo sapiens (human)
Pathway
Ribosome biogenesis in eukaryotes
Module
H/ACA ribonucleoprotein complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03008 Ribosome biogenesis in eukaryotes
    54433 (GAR1)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic Type
  Sno RNPs
   Box H/ACA snoRNPs
    54433 (GAR1)
DNA replication proteins [BR:hsa03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   Telomerase complex (animals)
    Dyskerin complex
     54433 (GAR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q9NY12(Tbio)
UniProt: 
Position
4q25
AA seq 217 aa AA seqDB search
MSFRGGGRGGFNRGGGGGGFNRGGSSNHFRGGGGGGGGGNFRGGGRGGFGRGGGRGGFNK
GQDQGPPERVVLLGEFLHPCEDDIVCKCTTDENKVPYFNAPVYLENKEQIGKVDEIFGQL
RDFYFSVKLSENMKASSFKKLQKFYIDPYKLLPLQRFLPRPPGEKGPPRGGGRGGRGGGR
GGGGRGGGRGGGFRGGRGGGGGGFRGGRGGGFRGRGH
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgtcttttcgaggcggaggtcgtggaggctttaatcgaggtggtggaggtggcggcttc
aaccgaggtggcagcagcaaccacttccgaggtggaggcggcggtggaggcggcggcaat
ttcagaggcggcggcaggggaggatttggacgagggggtggccgcggaggctttaacaaa
ggccaagaccaaggacctccagaacgtgtagtcttattaggagagttcctgcatccctgt
gaagatgacatagtttgtaaatgtaccacagatgaaaataaggtgccttatttcaatgct
cctgtttacttagaaaacaaagaacaaattggaaaagtggatgaaatatttggacaactc
agagatttttatttttcagttaagttgtcagaaaacatgaaggcttcatcctttaaaaaa
ctacagaagttttatatagacccatataagctgctgccactgcagaggtttttacctcga
cctccaggtgagaaaggacctccaagaggtggtggcaggggaggccgaggaggaggaaga
ggaggaggtggcagaggtggtggcagaggcggtggttttagaggtggaagaggaggtgga
ggtgggggcttcagaggaggaagaggtggtggtttcagagggagaggacattaa

DBGET integrated database retrieval system