KEGG   Homo sapiens (human): 54434Help
Entry
54434             CDS       T01001                                 

Gene name
SSH1, SSH1L
Definition
(RefSeq) slingshot protein phosphatase 1 (EC:3.1.3.16 3.1.3.48)
  KO
K05766  
protein phosphatase slingshot [EC:3.1.3.16 3.1.3.48]
Organism
hsa  Homo sapiens (human)
Pathway
Axon guidance
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    54434 (SSH1)
 Organismal Systems
  Development
   04360 Axon guidance
    54434 (SSH1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     54434 (SSH1)
    3.1.3.48  protein-tyrosine-phosphatase
     54434 (SSH1)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Slingshots
    54434 (SSH1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
12q24.11
AA seq 1049 aa AA seqDB search
MALVTLQRSPTPSAASSSASNSELEAGSEEDRKLNLSLSESFFMVKGAALFLQQGSSPQG
QRSLQHPHKHAGDLPQHLQVMINLLRCEDRIKLAVRLESAWADRVRYMVVVYSSGRQDTE
ENILLGVDFSSKESKSCTIGMVLRLWSDTKIHLDGDGGFSVSTAGRMHIFKPVSVQAMWS
ALQVLHKACEVARRHNYFPGGVALIWATYYESCISSEQSCINEWNAMQDLESTRPDSPAL
FVDKPTEGERTERLIKAKLRSIMMSQDLENVTSKEIRNELEKQMNCNLKELKEFIDNEML
LILGQMDKPSLIFDHLYLGSEWNASNLEELQGSGVDYILNVTREIDNFFPGLFAYHNIRV
YDEETTDLLAHWNEAYHFINKAKRNHSKCLVHCKMGVSRSASTVIAYAMKEFGWPLEKAY
NYVKQKRSITRPNAGFMRQLSEYEGILDASKQRHNKLWRQQTDSSLQQPVDDPAGPGDFL
PETPDGTPESQLPFLDDAAQPGLGPPLPCCFRRLSDPLLPSPEDETGSLVHLEDPEREAL
LEEAAPPAEVHRPARQPQQGSGLCEKDVKKKLEFGSPKGRSGSLLQVEETEREEGLGAGR
WGQLPTQLDQNLLNSENLNNNSKRSCPNGMEDDAIFGILNKVKPSYKSCADCMYPTASGA
PEASRERCEDPNAPAICTQPAFLPHITSSPVAHLASRSRVPEKPASGPTEPPPFLPPAGS
RRADTSGPGAGAALEPPASLLEPSRETPKVLPKSLLLKNSHCDKNPPSTEVVIKEESSPK
KDMKPAKDLRLLFSNESEKPTTNSYLMQHQESIIQLQKAGLVRKHTKELERLKSVPADPA
PPSRDGPASRLEASIPEESQDPAALHELGPLVMPSQAGSDEKSEAAPASLEGGSLKSPPP
FFYRLDHTSSFSKDFLKTICYTPTSSSMSSNLTRSSSSDSIHSVRGKPGLVKQRTQEIET
RLRLAGLTVSSPLKRSHSLAKLGSLTFSTEDLSSEADPSTVADSQDTTLSESSFLHEPQG
TPRDPAATSKPSGKPAPENLKSPSWMSKS
NT seq 3150 nt NT seq  +upstreamnt  +downstreamnt
atggccctggtgaccctgcagcgctcgcccacgcccagcgccgcctcctcctcggccagc
aacagcgagttggaggctggcagcgaagaagatcgaaaattaaacctcagcttaagtgag
agctttttcatggtgaaaggcgcagccctcttcttacaacagggaagcagccctcaaggc
cagcggagtcttcagcacccccacaagcatgcaggtgatctgcctcaacatcttcaggtg
atgatcaaccttctgcgttgcgaagacagaatcaagctggcagtgcgcctggagagcgcc
tgggcggaccgggtccggtacatggtggtggtgtacagcagcgggcgccaggacaccgag
gagaatatcttgctgggagtggacttttccagtaaggaaagtaaaagctgcaccattggg
atggttctccgactgtggagcgacacgaaaatccaccttgatggagatggtgggttcagc
gtgagcacagcaggaaggatgcacatatttaagcctgtgtctgtccaggccatgtggtct
gccctgcaggtgcttcacaaggcctgcgaagtggcccggaggcacaactacttccccggg
ggtgtagctctcatctgggctacctactatgagagctgcatcagctccgagcagagctgc
atcaacgagtggaacgccatgcaggacctggagtctacgcggcccgactcccccgcgcta
tttgtggacaagcccactgaaggggaaaggaccgagcgcctcatcaaagccaagctccga
agcatcatgatgagccaggatctagaaaatgtgacttccaaagagattcgtaatgaatta
gagaaacagatgaattgtaacttgaaggaactcaaggaatttatagacaatgagatgcta
cttatcttgggacagatggacaagccctcccttatcttcgatcatctttatctcggctct
gaatggaatgcatccaatctggaggaactgcagggctcaggggttgattacattttaaat
gttaccagagaaatcgataatttttttcctggcttatttgcatatcataacatccgagtc
tacgatgaagagaccacagacctcctcgcccactggaatgaagcgtatcattttataaac
aaagcgaagaggaaccattccaagtgcctggtgcattgcaaaatgggcgtgagtcgctcg
gcctccacagtcatagcctatgcaatgaaggaattcggctggcctctggaaaaagcatat
aactatgtaaagcagaagcgcagcatcacgcgccccaacgcgggctttatgaggcagctg
tctgagtatgaaggcatcttggatgcaagcaaacagcggcacaacaagctgtggcgtcag
cagacagacagcagcctccagcagcctgtggatgaccctgcaggacctggcgacttcttg
ccagagaccccagatggcaccccggaaagccagctgcccttcttggatgatgccgcccag
cccggcttagggccccccctcccctgctgtttccggcgactctcagacccccttctgcct
tcccctgaggatgaaactggcagcttggtccacctggaggatccggagagggaggctctg
ttggaggaagctgctccacctgcagaggtgcacaggccggccagacagccccagcaaggt
tccggactctgtgagaaggatgtgaagaagaaactagagtttgggagtcccaaaggtcgg
agcggctccttgctgcaggtggaggagacggaaagggaggagggcctgggagcagggagg
tgggggcagcttccaacccagctcgatcaaaacctgctcaactcggagaacctaaacaac
aacagcaagaggagctgtcccaacggcatggaggatgatgctatatttgggatccttaac
aaagtgaagccttcctataaatcctgtgccgactgcatgtaccctacagccagcggggct
cctgaggcctccagggagcgatgtgaggaccccaatgctcccgccatctgcacccagcca
gccttcctaccccacatcacgtcctcccctgtggcccacttggccagcaggtcccgtgtt
ccggagaagccagcctctggcccaaccgaacctcccccgttcctaccaccagcaggctcc
aggagggcagacaccagtggccctggggctggagctgccctagagccaccagccagcctt
ttggaaccttccagagagaccccaaaagtcctgccaaagtccctccttttgaagaattct
cactgtgataagaaccctcccagcacagaagtggtaataaaggaagaatcgtcacccaag
aaagatatgaagccagccaaggacctgaggcttctgttcagtaatgaatctgagaagccg
acaaccaacagctacctgatgcagcaccaggagtccatcattcagctgcagaaggcaggc
ttggtccgcaagcacaccaaagagctagagcggctgaagagcgtgcctgcagacccagca
cctccctccagggatggccctgccagcaggctggaggccagcatccccgaggagagccag
gatccagccgcgctccacgagctgggccccctggttatgcccagccaggccgggagtgat
gagaagtcagaggccgcccccgcttcattggaaggaggctcactgaagagcccccctcct
ttcttctaccgcctggaccacaccagtagtttctcaaaagactttctgaagaccatctgc
tacacccccacctcctcttccatgagctccaacctgacccggagctccagcagcgatagc
atccacagtgtccgtgggaagcccgggctggtgaagcagcggacacaggagattgagacc
cggctccggctggcgggcctcaccgtctcttccccactgaagcgctcacactctcttgcc
aagctggggagtctcaccttctcaacggaagacctgtccagtgaggctgacccgtccacc
gtcgctgactcccaggacaccactttgagtgaatcttccttcttgcatgagccccaggga
accccgagggacccagctgcaacctccaaaccatcagggaaacccgccccagaaaactta
aagagcccttcgtggatgagcaaaagctga

DBGET integrated database retrieval system