KEGG   Homo sapiens (human): 5445Help
Entry
5445              CDS       T01001                                 

Gene name
PON2
Definition
(RefSeq) paraoxonase 2
  KO
K01045  
arylesterase / paraoxonase [EC:3.1.1.2 3.1.8.1]
Organism
hsa  Homo sapiens (human)
Pathway
Metabolic pathways
Brite
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.2  arylesterase
     5445 (PON2)
   3.1.8  Phosphoric-triester hydrolases
    3.1.8.1  aryldialkylphosphatase
     5445 (PON2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   5445 (PON2)
  Exosomal proteins of other cancer cells
   5445 (PON2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q15165(Tbio)
UniProt: 
Position
7q21.3
AA seq 354 aa AA seqDB search
MGRLVAVGLLGIALALLGERLLALRNRLKASREVESVDLPHCHLIKGIEAGSEDIDILPN
GLAFFSVGLKFPGLHSFAPDKPGGILMMDLKEEKPRARELRISRGFDLASFNPHGISTFI
DNDDTVYLFVVNHPEFKNTVEIFKFEEAENSLLHLKTVKHELLPSVNDITAVGPAHFYAT
NDHYFSDPFLKYLETYLNLHWANVVYYSPNEVKVVAEGFDSANGINISPDDKYIYVADIL
AHEIHVLEKHTNMNLTQLKVLELDTLVDNLSIDPSSGDIWVGCHPNGQKLFVYDPNNPPS
SEVLRIQNILSEKPTVTTVYANNGSVLQGSSVASVYDGKLLIGTLYHRALYCEL
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atggggcggctggtggctgtgggcttgctggggatcgcgctggcgctcctgggcgagagg
cttctggcactcagaaatcgacttaaagcctccagagaagtagaatctgtagaccttcca
cactgccacctgattaaaggaattgaagctggctctgaagatattgacatacttcccaat
ggtctggctttttttagtgtgggtctaaaattcccaggactccacagctttgcaccagat
aagcctggaggaatactaatgatggatctaaaagaagaaaaaccaagggcacgggaatta
agaatcagtcgtgggtttgatttggcctcattcaatccacatggcatcagcactttcata
gacaacgatgacacagtttatctctttgttgtaaaccacccagaattcaagaatacagtg
gaaatttttaaatttgaagaagcagaaaattctctgttgcatctgaaaacagtcaaacat
gagcttcttccaagtgtgaatgacatcacagctgttggaccggcacatttctatgccaca
aatgaccactacttctctgatcctttcttaaagtatttagaaacatacttgaacttacac
tgggcaaatgttgtttactacagtccaaatgaagttaaagtggtagcagaaggatttgat
tcagcaaatgggatcaatatttcacctgatgataagtatatctatgttgctgacatattg
gctcatgaaattcatgttttggaaaaacacactaatatgaatttaactcagttgaaggta
cttgagctggatacactggtggataatttatctattgatccttcctcgggggacatctgg
gtaggctgtcatcctaatggccagaagctcttcgtgtatgacccgaacaatcctccctcg
tcagaggttctccgcatccagaacattctatctgagaagcctacagtgactacagtttat
gccaacaatgggtctgttctccaaggaagttctgtagcctcagtgtatgatgggaagctg
ctcataggcactttataccacagagccttgtattgtgaactctaa

DBGET integrated database retrieval system