KEGG   Homo sapiens (human): 54464Help
Entry
54464             CDS       T01001                                 

Gene name
XRN1, SEP1
Definition
5'-3' exoribonuclease 1
Orthology
K12618  
5'-3' exoribonuclease 1 [EC:3.1.13.-]
Organism
hsa  Homo sapiens (human)
Pathway
Ribosome biogenesis in eukaryotes
RNA degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03008 Ribosome biogenesis in eukaryotes
    54464 (XRN1)
  Folding, sorting and degradation
   03018 RNA degradation
    54464 (XRN1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.-  
     54464 (XRN1)
Transfer RNA biogenesis [BR:hsa03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    54464 (XRN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3q23
AA seq 1694 aa AA seqDB search
MGVPKFYRWISERYPCLSEVVKEHQIPEFDNLYLDMNGIIHQCSHPNDDDVHFRISDDKI
FTDIFHYLEVLFRIIKPRKVFFMAVDGVAPRAKMNQQRGRRFRSAKEAEDKIKKAIEKGE
TLPTEARFDSNCITPGTEFMARLHEHLKYFVNMKISTDKSWQGVTIYFSGHETPGEGEHK
IMEFIRSEKAKPDHDPNTRHCLYGLDADLIMLGLTSHEAHFSLLREEVRFGGKKTQRVCA
PEETTFHLLHLSLMREYIDYEFSVLKEKITFKYDIERIIDDWILMGFLVGNDFIPHLPHL
HINHDALPLLYGTYVTILPELGGYINESGHLNLPRFEKYLVKLSDFDREHFSEVFVDLKW
FESKVGNKYLNEAAGVAAEEARNYKEKKKLKGQENSLCWTALDKNEGEMITSKDNLEDET
EDDDLFETEFRQYKRTYYMTKMGVDVVSDDFLADQAACYVQAIQWILHYYYHGVQSWSWY
YPYHYAPFLSDIHNISTLKIHFELGKPFKPFEQLLAVLPAASKNLLPACYQHLMTNEDSP
IIEYYPPDFKTDLNGKQQEWEAVVLIPFIDEKRLLEAMETCNHSLKKEERKRNQHSECLM
CWYDRDTEFIYPSPWPEKFPAIERCCTRYKIISLDAWRVDINKNKITRIDQKALYFCGFP
TLKHIRHKFFLKKSGVQVFQQSSRGENMMLEILVDAESDELTVENVASSVLGKSVFVNWP
HLEEARVVAVSDGETKFYLEEPPGTQKLYSGRTAPPSKVVHLGDKEQSNWAKEVQGISEH
YLRRKGIIINETSAVVYAQLLTGRKYQINQNGEVRLEKQWSKQVVPFVYQTIVKDIRAFD
SRFSNIKTLDDLFPLRSMVFMLGTPYYGCTGEVQDSGDVITEGRIRVIFSIPCEPNLDAL
IQNQHKYSIKYNPGYVLASRLGVSGYLVSRFTGSIFIGRGSRRNPHGDHKANVGLNLKFN
KKNEEVPGYTKKVGSEWMYSSAAEQLLAEYLERAPELFSYIAKNSQEDVFYEDDIWPGEN
ENGAEKVQEIITWLKGHPVSTLSRSSCDLQILDAAIVEKIEEEVEKCKQRKNNKKVRVTV
KPHLLYRPLEQQHGVIPDRDAEFCLFDRVVNVRENFSVPVGLRGTIIGIKGANREADVLF
EVLFDEEFPGGLTIRCSPGRGYRLPTSALVNLSHGSRSETGNQKLTAIVKPQPAVHQHSS
SSSVSSGHLGALNHSPQSLFVPTQVPTKDDDEFCNIWQSLQGSGKMQYFQPTIQEKGAVL
PQEISQVNQHHKSGFNDNSVKYQQRKHDPHRKFKEECKSPKAECWSQKMSNKQPNSGIEN
FLASLNISKENEVQSSHHGEPPSEEHLSPQSFAMKGTRMLKEILKIDGSNTVDHKNEIKQ
IANEIPVSSNRRDEYGLPSQPKQNKKLASYMNKPHSANEYHNVQSMDNMCWPAPSQIPPV
STPVTELSRICSLVGMPQPDFSFLRMPQTMTVCQVKLSNGLLVHGPQCHSENEAKEKAAL
FALQQLGSLGMNFPLPSQVFANYPSAVPPGTIPPAFPPPTANIMPSSSHLFGSMPWGPSV
PVPGKPFHHTLYSGTMPMAGGIPGGVHNQFIPLQVTKKRVANKKNFENKEAQSSQATPVQ
TSQPDSSNIVKVSPRESSSASLKSSPIAQPASSFQVETASQGHSISHHKSTPISSSRRKS
RKLAVNFGVSKPSE
NT seq 5085 nt NT seq  +upstreamnt  +downstreamnt
atgggagtccccaagttttacagatggatctcagagcggtatccctgtctcagcgaagtg
gtgaaagagcatcagattcctgaatttgacaacttgtacctggatatgaatggaattata
catcagtgctcccatcctaatgatgatgatgttcactttagaatttcagatgataaaatc
tttactgatatttttcactacctggaggtgttgtttcgcattattaaacccaggaaagtg
ttctttatggctgtagatggtgtggctcctcgagcaaaaatgaaccagcagcgtgggagg
cgttttaggtcagcaaaggaggcagaagacaaaattaaaaaggcaatagagaagggagaa
actcttcctacagaggccagatttgattccaactgtatcacaccaggaactgaatttatg
gccaggttacatgaacatctgaagtattttgtaaatatgaaaatttccacagacaagtca
tggcaaggagttaccatctacttctcaggccatgagactcctggagaaggagagcataaa
atcatggaatttatcagatccgagaaagcaaagccagatcatgatccaaacaccagacac
tgtctttatggtttagatgctgacttgattatgcttggattaacaagtcatgaggcacat
ttttctctcttaagagaagaagttcgatttggtggcaaaaaaacacaacgggtatgtgct
ccagaagaaactacatttcaccttctacacttgtctttaatgagagagtatattgactat
gagttttcagtattaaaagaaaagatcacatttaaatatgatattgaaaggataatagat
gattggattttgatggggtttcttgttggtaatgattttatccctcatctacctcattta
catattaatcatgatgcactgcctcttctttatggaacatatgttaccatcctgccagaa
cttgggggttatattaatgaaagtgggcacctcaacttacctcgatttgagaaatacctt
gtgaaactatcagattttgatcgggagcacttcagtgaagtttttgtggacctaaaatgg
tttgaaagcaaagttggtaacaagtacctcaatgaagcagcaggtgtcgcagcagaagaa
gccaggaactacaaggaaaagaaaaagttaaagggccaggaaaattctctgtgttggact
gctttagacaaaaatgaaggcgaaatgataacttctaaggataatttagaagatgagact
gaagatgatgacctatttgaaactgagtttagacaatataaaagaacatattacatgacg
aagatgggggttgacgtagtatctgatgactttctggctgatcaagctgcatgttatgtt
caggcaatacagtggattttgcactattactatcatggagttcagtcctggagctggtat
tatccttatcattatgcacctttcctgtctgatatacacaacatcagtacactcaaaatc
cattttgaactaggaaaaccttttaagccatttgaacagcttcttgctgtacttccagca
gccagcaaaaatttacttcctgcatgctaccagcatttgatgaccaatgaagactcacca
attatagaatattacccacctgattttaaaactgacctaaatgggaaacaacaggaatgg
gaagctgtggtgttaatcccttttattgatgagaagcgattattggaagccatggagaca
tgtaaccactccctcaaaaaggaagagaggaaaagaaaccaacatagtgagtgcctaatg
tgctggtatgatagagacacagagtttatctatccttctccatggccagaaaagttccct
gccatagaacgatgttgtacaaggtataaaataatatccttagatgcttggcgtgtagac
ataaacaaaaacaaaataaccagaattgaccagaaagcattatatttctgtggatttcct
actctgaaacacatcagacacaaattttttttgaagaaaagtggtgttcaagtattccag
caaagcagtcgtggagaaaacatgatgttggaaatcttagtggatgcagaatcagatgaa
cttaccgtagaaaatgtagcttcatcagtgcttggaaaatctgtctttgttaattggcct
caccttgaggaagctagagtcgtggctgtatcagatggagaaactaagttttacttggaa
gaacctccaggaacacagaagctttattcaggaagaactgccccaccatctaaagtggtt
catcttggagataaagaacaatctaactgggcaaaagaagtacaaggaatttcagaacac
tacctgagaagaaaaggaataataataaatgaaacatctgcagttgtgtatgctcagtta
ctcacaggtcgtaaatatcaaataaatcaaaatggtgaagttcgtctagagaaacagtgg
tcaaaacaagttgttccttttgtttatcaaactattgtcaaggacatccgagctttcgac
tcccgtttctccaatatcaaaacattggatgatttgtttcctctgagaagtatggtcttt
atgctgggaactccctattatggctgcactggagaagttcaggattcaggtgatgtgatt
acagaaggtaggattcgtgtgattttcagcattccatgtgaacccaatcttgatgcttta
atacagaaccagcataaatattctataaagtacaacccaggatatgtgttggccagtcgc
cttggagtgagtggataccttgtttcaaggtttacaggaagtatttttattggaagagga
tctaggagaaaccctcatggagaccataaagcaaatgtgggtttaaatctcaaattcaac
aagaaaaatgaggaggtacctggatatactaagaaagttggaagtgaatggatgtattca
tctgcagcagaacaacttctggcagagtacttagagagagctccagaactatttagttat
atagccaaaaatagccaagaggatgtgttctatgaagatgacatttggcctggagaaaat
gagaatggtgctgaaaaagttcaagaaattattacttggctaaaaggacatcctgtcagt
actttatctcgttcttcttgtgatttacaaattctggatgcagctattgttgagaaaatt
gaggaagaagtcgaaaagtgcaagcaaagaaagaataataagaaggtgcgagtaacagtg
aaaccccatttgctatacagacctttagaacagcaacatggagtcattcctgatcgggat
gcagaattttgtctttttgaccgtgttgtaaatgtgagagaaaacttctcagttccagtt
ggccttcgaggcaccatcataggaataaaaggagctaatagagaagccgatgtactattt
gaagtattatttgatgaagaatttcctggagggttaacaataagatgctcacctggtaga
ggttatcgactgccaacaagtgccttggtgaacctttctcatgggagtcgctctgaaact
ggaaatcagaagttgacagccatcgtaaaaccacaaccagctgtacatcaacatagctca
agttcatcagtttcctctgggcatttgggagccctcaaccattcccctcaatcacttttt
gttcctactcaagtacctactaaagatgatgatgaattctgcaacatttggcagtcctta
cagggatctggaaagatgcaatactttcagccaactatacaagagaagggtgcagttcta
cctcaagaaataagccaagtaaatcaacatcataaatctggctttaatgacaacagtgtt
aaatatcagcaaagaaaacatgaccctcacagaaaatttaaagaagagtgtaagagtcct
aaagctgagtgttggtcccaaaaaatgtccaataagcagcctaactctggaattgagaac
tttttagcatctttgaatatctccaaagaaaatgaagtacagtcatctcatcatggggag
cctccaagtgaagagcatttgtcaccacagtcatttgccatgaagggaacacggatgctt
aaagaaattctaaaaattgatggctctaacactgtggaccataagaatgaaatcaaacag
attgctaatgaaatccctgtttcctctaacagaagagatgaatatggattaccctctcag
cctaaacaaaataagaaattagcatcttatatgaacaagcctcacagtgctaatgagtac
cataatgttcagtctatggacaatatgtgttggcctgcccccagccagatccctcctgta
tccacaccagtaactgaactttctcgaatttgttcccttgttggaatgccacaacctgat
ttctcctttcttaggatgccacagacaatgaccgtttgccaagtaaaattatctaatggc
ttactggtacatgggccacagtgccactctgaaaatgaagccaaagagaaagctgcactt
tttgctttacaacagttgggctccttaggcatgaatttccctttgccttcacaagtattt
gcaaattatccttcagctgtaccacctggaaccattcctccagcctttcccccacctact
gctaatataatgccttcgtcgtctcatctctttggctcaatgccatggggaccatcggtg
ccagttcctgggaagcccttccatcatactttatattctgggaccatgcccatggctggg
ggaataccagggggtgtgcacaatcagtttatacctctgcaggttactaaaaaaagggtt
gcaaacaaaaagaactttgagaataaggaagcccagagttctcaagccactccagttcag
actagccagccagattcttccaacattgtcaaagtaagtccacgggagagctcatcagct
tctttgaagtcctctccgattgctcaacctgcatcttcttttcaagttgaaactgcctct
caaggccatagtatatctcaccataagtcaacaccaatctcttcttcaagaagaaaatca
agaaaactggctgttaattttggtgtttctaaaccttctgagtaa

DBGET integrated database retrieval system