KEGG   Homo sapiens (human): 5447Help
Entry
5447              CDS       T01001                                 

Gene name
POR, CPR, CYPOR, P450R
Definition
P450 (cytochrome) oxidoreductase (EC:1.6.2.4)
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
hsa  Homo sapiens (human)
Disease
H00458  
Craniosynostosis
H00599  
46,XX disorders of sex development (Disorders related to androgen excess)
H00608  
46,XY disorders of sex development (Disorders in androgen synthesis or action)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
7q11.2
AA seq 680 aa AA seqDB search
MINMGDSHVDTSSTVSEAVAEEVSLFSMTDMILFSLIVGLLTYWFLFRKKKEEVPEFTKI
QTLTSSVRESSFVEKMKKTGRNIIVFYGSQTGTAEEFANRLSKDAHRYGMRGMSADPEEY
DLADLSSLPEIDNALVVFCMATYGEGDPTDNAQDFYDWLQETDVDLSGVKFAVFGLGNKT
YEHFNAMGKYVDKRLEQLGAQRIFELGLGDDDGNLEEDFITWREQFWPAVCEHFGVEATG
EESSIRQYELVVHTDIDAAKVYMGEMGRLKSYENQKPPFDAKNPFLAAVTTNRKLNQGTE
RHLMHLELDISDSKIRYESGDHVAVYPANDSALVNQLGKILGADLDVVMSLNNLDEESNK
KHPFPCPTSYRTALTYYLDITNPPRTNVLYELAQYASEPSEQELLRKMASSSGEGKELYL
SWVVEARRHILAILQDCPSLRPPIDHLCELLPRLQARYYSIASSSKVHPNSVHICAVVVE
YETKAGRINKGVATNWLRAKEPAGENGGRALVPMFVRKSQFRLPFKATTPVIMVGPGTGV
APFIGFIQERAWLRQQGKEVGETLLYYGCRRSDEDYLYREELAQFHRDGALTQLNVAFSR
EQSHKVYVQHLLKQDREHLWKLIEGGAHIYVCGDARNMARDVQNTFYDIVAELGAMEHAQ
AVDYIKKLMTKGRYSLDVWS
NT seq 2043 nt NT seq  +upstreamnt  +downstreamnt
atgatcaacatgggagactcccacgtggacaccagctccaccgtgtccgaggcggtggcc
gaagaagtatctcttttcagcatgacggacatgattctgttttcgctcatcgtgggtctc
ctaacctactggttcctcttcagaaagaaaaaagaagaagtccccgagttcaccaaaatt
cagacattgacctcctctgtcagagagagcagctttgtggaaaagatgaagaaaacgggg
aggaacatcatcgtgttctacggctcccagacggggactgcagaggagtttgccaaccgc
ctgtccaaggacgcccaccgctacgggatgcgaggcatgtcagcggaccctgaggagtat
gacctggccgacctgagcagcctgccagagatcgacaacgccctggtggttttctgcatg
gccacctacggtgagggagaccccaccgacaatgcccaggacttctacgactggctgcag
gagacagacgtggatctctctggggtcaagttcgcggtgtttggtcttgggaacaagacc
tacgagcacttcaatgccatgggcaagtacgtggacaagcggctggagcagctcggcgcc
cagcgcatctttgagctggggttgggcgacgacgatgggaacttggaggaggacttcatc
acctggcgagagcagttctggccggccgtgtgtgaacactttggggtggaagccactggc
gaggagtccagcattcgccagtacgagcttgtggtccacaccgacatagatgcggccaag
gtgtacatgggggagatgggccggctgaagagctacgagaaccagaagcccccctttgat
gccaagaatccgttcctggctgcagtcaccaccaaccggaagctgaaccagggaaccgag
cgccacctcatgcacctggaattggacatctcggactccaaaatcaggtatgaatctggg
gaccacgtggctgtgtacccagccaacgactctgctctcgtcaaccagctgggcaaaatc
ctgggtgccgacctggacgtcgtcatgtccctgaacaacctggatgaggagtccaacaag
aagcacccattcccgtgccctacgtcctaccgcacggccctcacctactacctggacatc
accaacccgccgcgtaccaacgtgctgtacgagctggcgcagtacgcctcggagccctcg
gagcaggagctgctgcgcaagatggcctcctcctccggcgagggcaaggagctgtacctg
agctgggtggtggaggcccggaggcacatcctggccatcctgcaggactgcccgtccctg
cggccccccatcgaccacctgtgtgagctgctgccgcgcctgcaggcccgctactactcc
atcgcctcatcctccaaggtccaccccaactctgtgcacatctgtgcggtggttgtggag
tacgagaccaaggctggccgcatcaacaagggcgtggccaccaactggctgcgggccaag
gagcctgccggggagaacggcggccgtgcgctggtgcccatgttcgtgcgcaagtcccag
ttccgcctgcccttcaaggccaccacgcctgtcatcatggtgggccccggcaccggggtg
gcacccttcataggcttcatccaggagcgggcctggctgcgacagcagggcaaggaggtg
ggggagacgctgctgtactacggctgccgccgctcggatgaggactacctgtaccgggag
gagctggcgcagttccacagggacggtgcgctcacccagctcaacgtggccttctcccgg
gagcagtcccacaaggtctacgtccagcacctgctaaagcaagaccgagagcacctgtgg
aagttgatcgaaggcggtgcccacatctacgtctgtggggatgcacggaacatggccagg
gatgtgcagaacaccttctacgacatcgtggctgagctcggggccatggagcacgcgcag
gcggtggactacatcaagaaactgatgaccaagggccgctactccctggacgtgtggagc
tag

DBGET integrated database retrieval system