KEGG   Homo sapiens (human): 54541Help
Entry
54541             CDS       T01001                                 

Gene name
DDIT4, Dig2, REDD-1, REDD1
Definition
DNA-damage-inducible transcript 4
Orthology
K08270  
DNA-damage-inducible transcript 4
Organism
hsa  Homo sapiens (human)
Pathway
mTOR signaling pathway
PI3K-Akt signaling pathway
MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    54541 (DDIT4)
   04150 mTOR signaling pathway
    54541 (DDIT4)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    54541 (DDIT4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
10q22.1
AA seq 232 aa AA seqDB search
MPSLWDRFSSSSTSSSPSSLPRTPTPDRPPRSAWGSATREEGFDRSTSLESSDCESLDSS
NSGFGPEEDTAYLDGVSLPDFELLSDPEDEHLCANLMQLLQESLAQARLGSRRPARLLMP
SQLVSQVGKELLRLAYSEPCGLRGALLDVCVEQGKSCHSVGQLALDPSLVPTFQLTLVLR
LDSRLWPKIQGLFSSANSPFLPGFSQSLTLSTGFRVIKKKLYSSEQLLIEEC
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgcctagcctttgggaccgcttctcgtcgtcgtccacctcctcttcgccctcgtccttg
ccccgaactcccaccccagatcggccgccgcgctcagcctgggggtcggcgacccgggag
gaggggtttgaccgctccacgagcctggagagctcggactgcgagtccctggacagcagc
aacagtggcttcgggccggaggaagacacggcttacctggatggggtgtcgttgcccgac
ttcgagctgctcagtgaccctgaggatgaacacttgtgtgccaacctgatgcagctgctg
caggagagcctggcccaggcgcggctgggctctcgacgccctgcgcgcctgctgatgcct
agccagttggtaagccaggtgggcaaagaactactgcgcctggcctacagcgagccgtgc
ggcctgcggggggcgctgctggacgtctgcgtggagcagggcaagagctgccacagcgtg
ggccagctggcactcgaccccagcctggtgcccaccttccagctgaccctcgtgctgcgc
ctggactcacgactctggcccaagatccaggggctgtttagctccgccaactctcccttc
ctccctggcttcagccagtccctgacgctgagcactggcttccgagtcatcaagaagaag
ctgtacagctcggaacagctgctcattgaggagtgttga

DBGET integrated database retrieval system