KEGG   Homo sapiens (human): 54552Help
Entry
54552             CDS       T01001                                 

Gene name
GNL3L, GNL3B
Definition
(RefSeq) G protein nucleolar 3 like
  KO
K14538  
nuclear GTP-binding protein
Organism
hsa  Homo sapiens (human)
Pathway
Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03008 Ribosome biogenesis in eukaryotes
    54552 (GNL3L)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic Type
  Pre-60S particles
   GTPases
    54552 (GNL3L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q9NVN8(Tbio)
UniProt: 
Position
Xp11.22
AA seq 582 aa AA seqDB search
MMKLRHKNKKPGEGSKGHKKISWPYPQPAKQNGKKATSKVPSAPHFVHPNDHANREAELK
KKWVEEMREKQQAAREQERQKRRTIESYCQDVLRRQEEFEHKEEVLQELNMFPQLDDEAT
RKAYYKEFRKVVEYSDVILEVLDARDPLGCRCFQMEEAVLRAQGNKKLVLVLNKIDLVPK
EVVEKWLDYLRNELPTVAFKASTQHQVKNLNRCSVPVDQASESLLKSKACFGAENLMRVL
GNYCRLGEVRTHIRVGVVGLPNVGKSSLINSLKRSRACSVGAVPGITKFMQEVYLDKFIR
LLDAPGIVPGPNSEVGTILRNCVHVQKLADPVTPVETILQRCNLEEISNYYGVSGFQTTE
HFLTAVAHRLGKKKKGGLYSQEQAAKAVLADWVSGKISFYIPPPATHTLPTHLSAEIVKE
MTEVFDIEDTEQANEDTMECLATGESDELLGDTDPLEMEIKLLHSPMTKIADAIENKTTV
YKIGDLTGYCTNPNRHQMGWAKRNVDHRPKSNSMVDVCSVDRRSVLQRIMETDPLQQGQA
LASALKNKKKMQKRADKIASKLSDSMMSALDLSGNADDGVGD
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaacttagacacaaaaataaaaagccaggtgaaggttccaagggccacaagaag
ataagttggccctaccctcagcctgcaaagcaaaatgggaagaaagcaacctccaaagtg
ccctctgcacctcattttgttcaccccaatgatcatgccaatcgagaggctgaattaaag
aagaagtgggttgaggagatgagggagaagcagcaagccgcccgggagcaagaaagacaa
aaacgcaggaccattgagagctactgtcaggatgtcctaagacgccaggaggagtttgag
cataaggaggaagttttgcaggaattaaatatgtttcctcagctggatgacgaggccacg
aggaaggcttattacaaggagttccgtaaggtggtggaatactctgatgtgattctggaa
gtcctggatgccagagacccattaggctgccgctgcttccaaatggaggaggctgtcctg
cgagcacaaggcaacaagaagctggtcctggtcttgaacaagattgacctggtccccaag
gaggttgtggagaaatggctggattaccttcggaatgagttgccaaccgtggctttcaag
gccagtacccagcatcaggtcaaaaacctgaatcgttgcagtgtgccagtagatcaggcc
tctgagtcactgctgaaaagcaaagcctgctttggagctgaaaacctcatgagggttctg
gggaactattgccgccttggtgaagtgcgcacccacattcgtgtgggtgttgtgggtctt
cccaatgttgggaagagcagcctgatcaatagcctgaagcgcagccgcgcatgcagcgtg
ggagctgttcctggaattaccaaattcatgcaggaggtctacctggacaagttcatccgg
ctcttggatgctccaggcattgtcccagggcccaactcagaggtgggcaccatcctgcgt
aactgcgtccacgtgcagaagctggcagaccctgtgaccccagtggagaccatcctgcag
cgctgcaacctggaggagatttccaactattatggcgtctctgggttccagaccactgag
cactttctgacggcagtggcccaccgtttggggaagaagaagaagggaggcttatatagt
caggaacaggcggccaaagctgtcctagctgactgggtgagcgggaagatcagcttctat
ataccaccaccagccactcacactctgcccacccatctcagtgctgagatcgttaaggaa
atgaccgaggtctttgacatcgaggatactgagcaggccaatgaagacaccatggaatgc
ttggccaccggagaatctgatgagctgttgggtgacacggacccacttgaaatggagatc
aagttgctccattctccgatgacgaaaatagcagatgccattgaaaataaaaccaccgtg
tataagattggagatctcactgggtattgcaccaatccgaaccgtcatcagatggggtgg
gctaaacgcaatgtggaccaccgccctaagagcaacagtatggtggatgtctgctcagtg
gaccgccgctcagtgctgcagaggatcatggagacggaccccctgcaacagggccaggct
ctggcatctgccctgaaaaataagaagaagatgcagaaacgtgcagataaaatcgccagc
aagctgtctgattccatgatgtctgctctcgacctctctggcaatgctgatgatggtgtt
ggtgactaa

DBGET integrated database retrieval system