KEGG   Homo sapiens (human): 54567Help
Entry
54567             CDS       T01001                                 

Gene name
DLL4, hdelta2
Definition
delta-like 4 (Drosophila)
Orthology
K06051  
delta
Organism
hsa  Homo sapiens (human)
Pathway
Notch signaling pathway
Module
Notch signaling
Drug target
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    54567 (DLL4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
15q14
AA seq 685 aa AA seqDB search
MAAASRSASGWALLLLVALWQQRAAGSGVFQLQLQEFINERGVLASGRPCEPGCRTFFRV
CLKHFQAVVSPGPCTFGTVSTPVLGTNSFAVRDDSSGGGRNPLQLPFNFTWPGTFSLIIE
AWHAPGDDLRPEALPPDALISKIAIQGSLAVGQNWLLDEQTSTLTRLRYSYRVICSDNYY
GDNCSRLCKKRNDHFGHYVCQPDGNLSCLPGWTGEYCQQPICLSGCHEQNGYCSKPAECL
CRPGWQGRLCNECIPHNGCRHGTCSTPWQCTCDEGWGGLFCDQDLNYCTHHSPCKNGATC
SNSGQRSYTCTCRPGYTGVDCELELSECDSNPCRNGGSCKDQEDGYHCLCPPGYYGLHCE
HSTLSCADSPCFNGGSCRERNQGANYACECPPNFTGSNCEKKVDRCTSNPCANGGQCLNR
GPSRMCRCRPGFTGTYCELHVSDCARNPCAHGGTCHDLENGLMCTCPAGFSGRRCEVRTS
IDACASSPCFNRATCYTDLSTDTFVCNCPYGFVGSRCEFPVGLPPSFPWVAVSLGVGLAV
LLVLLGMVAVAVRQLRLRRPDDGSREAMNNLSDFQKDNLIPAAQLKNTNQKKELEVDCGL
DKSNCGKQQNHTLDYNLAPGPLGRGTMPGKFPHSDKSLGEKAPLRLHSEKPECRISAICS
PRDSMYQSVCLISEERNECVIATEV
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
atggcggcagcgtcccggagcgcctctggctgggcgctactgctgctggtggcactttgg
cagcagcgcgcggccggctccggcgtcttccagctgcagctgcaggagttcatcaacgag
cgcggcgtactggccagtgggcggccttgcgagcccggctgccggactttcttccgcgtc
tgccttaagcacttccaggcggtcgtctcgcccggaccctgcaccttcgggaccgtctcc
acgccggtattgggcaccaactccttcgctgtccgggacgacagtagcggcggggggcgc
aaccctctccaactgcccttcaatttcacctggccgggtaccttctcgctcatcatcgaa
gcttggcacgcgccaggagacgacctgcggccagaggccttgccaccagatgcactcatc
agcaagatcgccatccagggctccctagctgtgggtcagaactggttattggatgagcaa
accagcaccctcacaaggctgcgctactcttaccgggtcatctgcagtgacaactactat
ggagacaactgctcccgcctgtgcaagaagcgcaatgaccacttcggccactatgtgtgc
cagccagatggcaacttgtcctgcctgcccggttggactggggaatattgccaacagcct
atctgtctttcgggctgtcatgaacagaatggctactgcagcaagccagcagagtgcctc
tgccgcccaggctggcagggccggctgtgtaacgaatgcatcccccacaatggctgtcgc
cacggcacctgcagcactccctggcaatgtacttgtgatgagggctggggaggcctgttt
tgtgaccaagatctcaactactgcacccaccactccccatgcaagaatggggcaacgtgc
tccaacagtgggcagcgaagctacacctgcacctgtcgcccaggctacactggtgtggac
tgtgagctggagctcagcgagtgtgacagcaacccctgtcgcaatggaggcagctgtaag
gaccaggaggatggctaccactgcctgtgtcctccgggctactatggcctgcattgtgaa
cacagcaccttgagctgcgccgactccccctgcttcaatgggggctcctgccgggagcgc
aaccagggggccaactatgcttgtgaatgtccccccaacttcaccggctccaactgcgag
aagaaagtggacaggtgcaccagcaacccctgtgccaacgggggacagtgcctgaaccga
ggtccaagccgcatgtgccgctgccgtcctggattcacgggcacctactgtgaactccac
gtcagcgactgtgcccgtaacccttgcgcccacggtggcacttgccatgacctggagaat
gggctcatgtgcacctgccctgccggcttctctggccgacgctgtgaggtgcggacatcc
atcgatgcctgtgcctcgagtccctgcttcaacagggccacctgctacaccgacctctcc
acagacacctttgtgtgcaactgcccttatggctttgtgggcagccgctgcgagttcccc
gtgggcttgccgcccagcttcccctgggtggccgtctcgctgggtgtggggctggcagtg
ctgctggtactgctgggcatggtggcagtggctgtgcggcagctgcggcttcgacggccg
gacgacggcagcagggaagccatgaacaacttgtcggacttccagaaggacaacctgatt
cctgccgcccagcttaaaaacacaaaccagaagaaggagctggaagtggactgtggcctg
gacaagtccaactgtggcaaacagcaaaaccacacattggactataatctggccccaggg
cccctggggcgggggaccatgccaggaaagtttccccacagtgacaagagcttaggagag
aaggcgccactgcggttacacagtgaaaagccagagtgtcggatatcagcgatatgctcc
cccagggactccatgtaccagtctgtgtgtttgatatcagaggagaggaatgaatgtgtc
attgccacggaggtataa

DBGET integrated database retrieval system