KEGG   Homo sapiens (human): 54567Help
Entry
54567             CDS       T01001                                 

Gene name
DLL4, AOS6, hdelta2
Definition
(RefSeq) delta like canonical Notch ligand 4
  KO
K06051  delta
Organism
hsa  Homo sapiens (human)
Pathway
hsa01522  Endocrine resistance
hsa04330  Notch signaling pathway
hsa04658  Th1 and Th2 cell differentiation
hsa05200  Pathways in cancer
hsa05224  Breast cancer
Module
hsa_M00682  Notch signaling
Network
N00086  Notch signaling pathway
N00087  NOTCH-overexpression to Notch signaling pathway
Disease
H01413  Adams-Oliver syndrome (AOS)
Drug target
Demcizumab: D10353
Enoticumab: D10460
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    54567 (DLL4)
 Organismal Systems
  Immune system
   04658 Th1 and Th2 cell differentiation
    54567 (DLL4)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    54567 (DLL4)
   05224 Breast cancer
    54567 (DLL4)
  Drug resistance
   01522 Endocrine resistance
    54567 (DLL4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EGF DSL hEGF MNNL EGF_2 DUF4381 EGF_3 EGF_CA
Motif
Other DBs
NCBI-GeneID: 54567
NCBI-ProteinID: NP_061947
OMIM: 605185
HGNC: 2910
Ensembl: ENSG00000128917
Vega: OTTHUMG00000172511
Pharos: Q9NR61(Tbio)
UniProt: Q9NR61
Structure
PDB: 

Jmol
Position
15q15.1
AA seq 685 aa AA seqDB search
MAAASRSASGWALLLLVALWQQRAAGSGVFQLQLQEFINERGVLASGRPCEPGCRTFFRV
CLKHFQAVVSPGPCTFGTVSTPVLGTNSFAVRDDSSGGGRNPLQLPFNFTWPGTFSLIIE
AWHAPGDDLRPEALPPDALISKIAIQGSLAVGQNWLLDEQTSTLTRLRYSYRVICSDNYY
GDNCSRLCKKRNDHFGHYVCQPDGNLSCLPGWTGEYCQQPICLSGCHEQNGYCSKPAECL
CRPGWQGRLCNECIPHNGCRHGTCSTPWQCTCDEGWGGLFCDQDLNYCTHHSPCKNGATC
SNSGQRSYTCTCRPGYTGVDCELELSECDSNPCRNGGSCKDQEDGYHCLCPPGYYGLHCE
HSTLSCADSPCFNGGSCRERNQGANYACECPPNFTGSNCEKKVDRCTSNPCANGGQCLNR
GPSRMCRCRPGFTGTYCELHVSDCARNPCAHGGTCHDLENGLMCTCPAGFSGRRCEVRTS
IDACASSPCFNRATCYTDLSTDTFVCNCPYGFVGSRCEFPVGLPPSFPWVAVSLGVGLAV
LLVLLGMVAVAVRQLRLRRPDDGSREAMNNLSDFQKDNLIPAAQLKNTNQKKELEVDCGL
DKSNCGKQQNHTLDYNLAPGPLGRGTMPGKFPHSDKSLGEKAPLRLHSEKPECRISAICS
PRDSMYQSVCLISEERNECVIATEV
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
atggcggcagcgtcccggagcgcctctggctgggcgctactgctgctggtggcactttgg
cagcagcgcgcggccggctccggcgtcttccagctgcagctgcaggagttcatcaacgag
cgcggcgtactggccagtgggcggccttgcgagcccggctgccggactttcttccgcgtc
tgccttaagcacttccaggcggtcgtctcgcccggaccctgcaccttcgggaccgtctcc
acgccggtattgggcaccaactccttcgctgtccgggacgacagtagcggcggggggcgc
aaccctctccaactgcccttcaatttcacctggccgggtaccttctcgctcatcatcgaa
gcttggcacgcgccaggagacgacctgcggccagaggccttgccaccagatgcactcatc
agcaagatcgccatccagggctccctagctgtgggtcagaactggttattggatgagcaa
accagcaccctcacaaggctgcgctactcttaccgggtcatctgcagtgacaactactat
ggagacaactgctcccgcctgtgcaagaagcgcaatgaccacttcggccactatgtgtgc
cagccagatggcaacttgtcctgcctgcccggttggactggggaatattgccaacagcct
atctgtctttcgggctgtcatgaacagaatggctactgcagcaagccagcagagtgcctc
tgccgcccaggctggcagggccggctgtgtaacgaatgcatcccccacaatggctgtcgc
cacggcacctgcagcactccctggcaatgtacttgtgatgagggctggggaggcctgttt
tgtgaccaagatctcaactactgcacccaccactccccatgcaagaatggggcaacgtgc
tccaacagtgggcagcgaagctacacctgcacctgtcgcccaggctacactggtgtggac
tgtgagctggagctcagcgagtgtgacagcaacccctgtcgcaatggaggcagctgtaag
gaccaggaggatggctaccactgcctgtgtcctccgggctactatggcctgcattgtgaa
cacagcaccttgagctgcgccgactccccctgcttcaatgggggctcctgccgggagcgc
aaccagggggccaactatgcttgtgaatgtccccccaacttcaccggctccaactgcgag
aagaaagtggacaggtgcaccagcaacccctgtgccaacgggggacagtgcctgaaccga
ggtccaagccgcatgtgccgctgccgtcctggattcacgggcacctactgtgaactccac
gtcagcgactgtgcccgtaacccttgcgcccacggtggcacttgccatgacctggagaat
gggctcatgtgcacctgccctgccggcttctctggccgacgctgtgaggtgcggacatcc
atcgatgcctgtgcctcgagtccctgcttcaacagggccacctgctacaccgacctctcc
acagacacctttgtgtgcaactgcccttatggctttgtgggcagccgctgcgagttcccc
gtgggcttgccgcccagcttcccctgggtggccgtctcgctgggtgtggggctggcagtg
ctgctggtactgctgggcatggtggcagtggctgtgcggcagctgcggcttcgacggccg
gacgacggcagcagggaagccatgaacaacttgtcggacttccagaaggacaacctgatt
cctgccgcccagcttaaaaacacaaaccagaagaaggagctggaagtggactgtggcctg
gacaagtccaactgtggcaaacagcaaaaccacacattggactataatctggccccaggg
cccctggggcgggggaccatgccaggaaagtttccccacagtgacaagagcttaggagag
aaggcgccactgcggttacacagtgaaaagccagagtgtcggatatcagcgatatgctcc
cccagggactccatgtaccagtctgtgtgtttgatatcagaggagaggaatgaatgtgtc
attgccacggaggtataa

DBGET integrated database retrieval system