KEGG   Homo sapiens (human): 54576Help
Entry
54576             CDS       T01001                                 

Gene name
UGT1A8, UDPGT, UDPGT_1-8, UGT-1H, UGT1-08, UGT1.8, UGT1A8S, UGT1H
Definition
UDP glucuronosyltransferase 1 family, polypeptide A8 (EC:2.4.1.17)
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
hsa  Homo sapiens (human)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Steroid hormone biosynthesis
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Chemical carcinogenesis
Module
Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    54576 (UGT1A8)
   00053 Ascorbate and aldarate metabolism
    54576 (UGT1A8)
   00500 Starch and sucrose metabolism
    54576 (UGT1A8)
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    54576 (UGT1A8)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    54576 (UGT1A8)
   00860 Porphyrin and chlorophyll metabolism
    54576 (UGT1A8)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    54576 (UGT1A8)
   00982 Drug metabolism - cytochrome P450
    54576 (UGT1A8)
   00983 Drug metabolism - other enzymes
    54576 (UGT1A8)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    54576 (UGT1A8)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     54576 (UGT1A8)
Glycosyltransferases [BR:hsa01003]
 Others
  Hydrophobic molecule
   54576 (UGT1A8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2q37
AA seq 530 aa AA seqDB search
MARTGWTSPIPLCVSLLLTCGFAEAGKLLVVPMDGSHWFTMQSVVEKLILRGHEVVVVMP
EVSWQLGKSLNCTVKTYSTSYTLEDLDREFMDFADAQWKAQVRSLFSLFLSSSNGFFNLF
FSHCRSLFNDRKLVEYLKESSFDAVFLDPFDACGLIVAKYFSLPSVVFARGIACHYLEEG
AQCPAPLSYVPRILLGFSDAMTFKERVRNHIMHLEEHLFCQYFSKNALEIASEILQTPVT
AYDLYSHTSIWLLRTDFVLDYPKPVMPNMIFIGGINCHQGKPLPMEFEAYINASGEHGIV
VFSLGSMVSEIPEKKAMAIADALGKIPQTVLWRYTGTRPSNLANNTILVKWLPQNDLLGH
PMTRAFITHAGSHGVYESICNGVPMVMMPLFGDQMDNAKRMETKGAGVTLNVLEMTSEDL
ENALKAVINDKSYKENIMRLSSLHKDRPVEPLDLAVFWVEFVMRHKGAPHLRPAAHDLTW
YQYHSLDVIGFLLAVVLTVAFITFKCCAYGYRKCLGKKGRVKKAHKSKTH
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atggctcgcacagggtggaccagccccattcccctatgtgtttctctgctgctgacctgt
ggctttgctgaggcagggaagctgctggtagtgcccatggatgggagtcactggttcacc
atgcagtcggtggtggagaaacttatcctcagggggcatgaggtggttgtagtcatgcca
gaggtgagttggcaactgggaaaatcactgaattgcacagtgaagacttactcaacctca
tacactctggaggatctggaccgggaattcatggatttcgccgatgctcaatggaaagca
caagtacgaagtttgttttctctatttctgagttcatccaatggtttttttaacttattt
ttttcgcattgcaggagtttgtttaatgaccgaaaattagtagaatacttaaaggagagt
tcttttgatgcggtgtttcttgatccttttgatgcctgtggcttaattgttgccaaatat
ttctccctcccctctgtggtcttcgccaggggaatagcttgccactatcttgaagaaggt
gcacagtgccctgctcctctttcctatgtccccagaattctcttagggttctcagatgcc
atgactttcaaggagagagtacggaaccacatcatgcacttggaggaacatttattttgc
cagtatttttccaaaaatgccctagaaatagcctctgaaattctccaaacacctgtcaca
gcatatgatctctacagccacacatcaatttggttgttgcgaacagactttgttttggac
tatcccaaacccgtgatgcccaatatgatcttcattggtggtatcaactgccatcaggga
aagccattgcctatggaatttgaagcctacattaatgcttctggagaacatggaattgtg
gttttctctttgggatcaatggtctcagaaattccagagaagaaagctatggcaattgct
gatgctttgggcaaaatccctcagacagtcctgtggcggtacactggaacccgaccatcg
aatcttgcgaacaacacgatacttgttaagtggctaccccaaaacgatctgcttggtcac
ccgatgacccgtgcctttatcacccatgctggttcccatggtgtttatgaaagcatatgc
aatggcgttcccatggtgatgatgcccttgtttggtgatcagatggacaatgcaaagcgc
atggagactaagggagctggagtgaccctgaatgttctggaaatgacttctgaagattta
gaaaatgctctaaaagcagtcatcaatgacaaaagttacaaggagaacatcatgcgcctc
tccagccttcacaaggaccgcccggtggagccgctggacctggccgtgttctgggtggag
tttgtgatgaggcacaagggcgcgccacacctgcgccccgcagcccacgacctcacctgg
taccagtaccattccttggacgtgattggtttcctcttggccgtcgtgctgacagtggcc
ttcatcacctttaaatgttgtgcttatggctaccggaaatgcttggggaaaaaagggcga
gttaagaaagcccacaaatccaagacccattga

DBGET integrated database retrieval system