KEGG   Homo sapiens (human): 54578Help
Entry
54578             CDS       T01001                                 

Gene name
UGT1A6, GNT1, HLUGP, HLUGP1, UDPGT, UDPGT_1-6, UGT1, UGT1A6S, UGT1F
Definition
(RefSeq) UDP glucuronosyltransferase family 1 member A6
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00040  Pentose and glucuronate interconversions
hsa00053  Ascorbate and aldarate metabolism
hsa00140  Steroid hormone biosynthesis
hsa00830  Retinol metabolism
hsa00860  Porphyrin and chlorophyll metabolism
hsa00980  Metabolism of xenobiotics by cytochrome P450
hsa00982  Drug metabolism - cytochrome P450
hsa00983  Drug metabolism - other enzymes
hsa01100  Metabolic pathways
hsa05204  Chemical carcinogenesis
Module
hsa_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    54578 (UGT1A6)
   00053 Ascorbate and aldarate metabolism
    54578 (UGT1A6)
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    54578 (UGT1A6)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    54578 (UGT1A6)
   00860 Porphyrin and chlorophyll metabolism
    54578 (UGT1A6)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    54578 (UGT1A6)
   00982 Drug metabolism - cytochrome P450
    54578 (UGT1A6)
   00983 Drug metabolism - other enzymes
    54578 (UGT1A6)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    54578 (UGT1A6)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     54578 (UGT1A6)
Glycosyltransferases [BR:hsa01003]
 Others
  Hydrophobic molecule
   54578 (UGT1A6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C
Motif
Other DBs
NCBI-GeneID: 54578
NCBI-ProteinID: NP_001063
OMIM: 606431
HGNC: 12538
Ensembl: ENSG00000167165
Vega: OTTHUMG00000059122
Pharos: P19224(Tbio)
UniProt: P19224 Q5DSZ8
Position
2q37.1
AA seq 532 aa AA seqDB search
MACLLRSFQRISAGVFFLALWGMVVGDKLLVVPQDGSHWLSMKDIVEVLSDRGHEIVVVV
PEVNLLLKESKYYTRKIYPVPYDQEELKNRYQSFGNNHFAERSFLTAPQTEYRNNMIVIG
LYFINCQSLLQDRDTLNFFKESKFDALFTDPALPCGVILAEYLGLPSVYLFRGFPCSLEH
TFSRSPDPVSYIPRCYTKFSDHMTFSQRVANFLVNLLEPYLFYCLFSKYEELASAVLKRD
VDIITLYQKVSVWLLRYDFVLEYPRPVMPNMVFIGGINCKKRKDLSQEFEAYINASGEHG
IVVFSLGSMVSEIPEKKAMAIADALGKIPQTVLWRYTGTRPSNLANNTILVKWLPQNDLL
GHPMTRAFITHAGSHGVYESICNGVPMVMMPLFGDQMDNAKRMETKGAGVTLNVLEMTSE
DLENALKAVINDKSYKENIMRLSSLHKDRPVEPLDLAVFWVEFVMRHKGAPHLRPAAHDL
TWYQYHSLDVIGFLLAVVLTVAFITFKCCAYGYRKCLGKKGRVKKAHKSKTH
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atggcctgcctccttcgctcatttcagagaatttctgcaggggttttcttcttagcactt
tggggcatggttgtaggtgacaagctgctggtggtccctcaggacggaagccactggctt
agtatgaaggatatagttgaggttctcagtgaccggggtcatgagattgtagtggtggtg
cctgaagttaatttgcttttgaaagaatccaaatactacacaagaaaaatctatccagtg
ccgtatgaccaagaagagctgaagaaccgttaccaatcatttggaaacaatcactttgct
gagcgatcattcctaactgctcctcagacagagtacaggaataacatgattgttattggc
ctgtacttcatcaactgccagagcctcctgcaggacagggacaccctgaacttctttaag
gagagcaagtttgatgctcttttcacagacccagccttaccctgtggggtgatcctggct
gagtatttgggcctaccatctgtgtacctcttcaggggttttccgtgttccctggagcat
acattcagcagaagcccagaccctgtgtcctacattcccaggtgctacacaaagttttca
gaccacatgactttttcccaacgagtggccaacttccttgttaatttgttggagccctat
ctattttattgtctgttttcaaagtatgaagaactcgcatcagctgtcctcaagagagat
gtggatataatcaccttatatcagaaggtctctgtttggctgttaagatatgactttgtg
cttgaatatcctaggccggtcatgcccaacatggtcttcattggaggtatcaactgtaag
aagaggaaagacttgtctcaggaatttgaagcctacattaatgcttctggagaacatgga
attgtggttttctctttgggatcaatggtctcagaaattccagagaagaaagctatggca
attgctgatgctttgggcaaaatccctcagacagtcctgtggcggtacactggaacccga
ccatcgaatcttgcgaacaacacgatacttgttaagtggctaccccaaaacgatctgctt
ggtcacccgatgacccgtgcctttatcacccatgctggttcccatggtgtttatgaaagc
atatgcaatggcgttcccatggtgatgatgcccttgtttggtgatcagatggacaatgca
aagcgcatggagactaagggagctggagtgaccctgaatgttctggaaatgacttctgaa
gatttagaaaatgctctaaaagcagtcatcaatgacaaaagttacaaggagaacatcatg
cgcctctccagccttcacaaggaccgcccggtggagccgctggacctggccgtgttctgg
gtggagtttgtgatgaggcacaagggcgcgccacacctgcgccccgcagcccacgacctc
acctggtaccagtaccattccttggacgtgattggtttcctcttggccgtcgtgctgaca
gtggccttcatcacctttaaatgttgtgcttatggctaccggaaatgcttggggaaaaaa
gggcgagttaagaaagcccacaaatccaagacccattga

DBGET integrated database retrieval system