KEGG   Homo sapiens (human): 54585Help
Entry
54585             CDS       T01001                                 

Gene name
LZTFL1, BBS17
Definition
(RefSeq) leucine zipper transcription factor like 1
  KO
K19400  
leucine zipper transcription factor-like protein 1
Organism
hsa  Homo sapiens (human)
Disease
H00418  
Bardet-Biedl syndrome (BBS)
Brite
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   BBSome complex
    54585 (LZTFL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q9NQ48(Tbio)
UniProt: 
Position
3p21.31
AA seq 299 aa AA seqDB search
MAELGLNEHHQNEVINYMRFARSKRGLRLKTVDSCFQDLKESRLVEDTFTIDEVSEVLNG
LQAVVHSEVESELINTAYTNVLLLRQLFAQAEKWYLKLQTDISELENRELLEQVAEFEKA
EITSSNKKPILDVTKPKLAPLNEGGTAELLNKEILRLQEENEKLKSRLKTIEIQATNALD
EKSKLEKALQDLQLDQGNQKDFIKAQDLSNLENTVAALKSEFQKTLNDKTENQKSLEENL
ATAKHDLLRVQEQLHMAEKELEKKFQQTAAYRNMKEILTKKNDQIKDLRKRLAQYEPED
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atggcagagttgggcctaaatgagcaccatcaaaatgaagttattaattatatgcgtttt
gctcgttcaaagagaggcttgagactcaaaactgtagattcctgcttccaagacctcaag
gagagcaggctggtggaggacaccttcaccatagatgaagtctctgaagtcctcaatgga
ttacaagctgtggttcatagtgaggtggaatctgagctcatcaacactgcctataccaat
gtgttacttctgcgacagctgtttgcacaagctgagaagtggtatcttaagctacagaca
gacatctctgaacttgaaaaccgagaattattagaacaagttgcagaatttgaaaaagca
gagattacatcttcaaacaaaaagcccatcttagatgtcacaaagccaaaacttgctcca
cttaatgaaggtggaacagcagaactcctaaacaaggaaattttaagacttcaagaagag
aatgagaaattgaagtcaaggttgaagaccattgaaatacaggctacaaatgcactggat
gaaaagtcaaaactagaaaaagcactgcaagatttacagcttgatcaaggaaatcaaaag
gattttataaaggcccaagacttaagtaacttagaaaacactgtcgctgccttaaagagt
gagtttcagaagacacttaatgacaagacagaaaaccagaagtcactggaggagaatctg
gcgacagccaagcacgatctactcagggttcaggagcagctgcacatggctgaaaaggaa
ttagaaaagaaatttcagcaaacagcagcttatcgaaacatgaaagagattcttaccaag
aagaatgaccaaatcaaagatctgaggaaaagactggcacaatatgaacctgaagattaa

DBGET integrated database retrieval system